Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G27970 72 / 4e-16 ARM repeat superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000943 [exp] 73 / 1e-16 AT5G27970 2064 / 0.0 ARM repeat superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G035100 [exp] 70 / 1e-15 AT5G27970 2284 / 0.0 ARM repeat superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004117 pacid=23157528 polypeptide=Lus10004117 locus=Lus10004117.g ID=Lus10004117.BGIv1.0 annot-version=v1.0 ATGGCTCTCATGGCGGCCCTGGAATCTGACCTCCGGGCGCTGTCCGCCGAAGCTCGCCGCCGGTATCCCGCCGTTAAAGACGGGGCGGAGCATGCGATCT TGAAGGTTAGAGTTGTGAAAAAATGTGATGATGCGTGCAATTCAAGTTTCATATGGCCAGTCAGTTGCCCGAGAATGCTGATCAGTAGAATATTCCCGGA GAAATGTGAATCCGTCGGTTCGGTTGGGTTTATAGGAGGAAATGAGAGTAGAGTTTAG
AA sequence Show only first row Show all	>Lus10004117 pacid=23157528 polypeptide=Lus10004117 locus=Lus10004117.g ID=Lus10004117.BGIv1.0 annot-version=v1.0 MALMAALESDLRALSAEARRRYPAVKDGAEHAILKVRVVKKCDDACNSSFIWPVSCPRMLISRIFPEKCESVGSVGFIGGNESRV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G27970			ARM repeat superfamily protein...		Lus10004117 [exp]	0	1
AT1G58250		SAB	SABRE, Golgi-body localisation...		Lus10024283 [exp]	1.7	0.9801
AT5G27970			ARM repeat superfamily protein...		Lus10004116 [exp]	2.4	0.9744
AT5G10470		KAC1, KCA1	KINESIN CDKA;1 ASSOCIATED 1, k...		Lus10035941 [exp]	4.5	0.9712
AT3G63460		EMB2221	transducin family protein / WD...		Lus10016374 [exp]	4.6	0.9694
AT3G02260		CRM1, TIR3, LPR...	UMBRELLA 1, TRANSPORT INHIBITO...		Lus10000087 [exp]	5.2	0.9744
AT4G39420			unknown protein		Lus10006814 [exp]	6.7	0.9709
AT5G23110			Zinc finger, C3HC4 type (RING ...		Lus10001530 [exp]	7.7	0.9639
AT3G19640		MRS2-3, MGT4	magnesium transporter 4 (.1)		Lus10026746 [exp]	7.9	0.9270
AT2G21390			Coatomer, alpha subunit (.1)		Lus10035884 [exp]	8.1	0.9647
AT3G02260		CRM1, TIR3, LPR...	UMBRELLA 1, TRANSPORT INHIBITO...		Lus10034360 [exp]	8.5	0.9695

Compare expression of checked genes

Lus10004117 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.