Lus10004123 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G28060 205 / 3e-69 Ribosomal protein S24e family protein (.1)
AT3G04920 185 / 2e-61 Ribosomal protein S24e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000938 254 / 1e-88 AT5G28060 219 / 5e-75 Ribosomal protein S24e family protein (.1)
Lus10015941 133 / 2e-41 AT5G28060 132 / 1e-41 Ribosomal protein S24e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G087800 207 / 3e-70 AT5G28060 223 / 9e-77 Ribosomal protein S24e family protein (.1)
Potri.008G152500 207 / 3e-70 AT5G28060 221 / 1e-75 Ribosomal protein S24e family protein (.1)
Potri.005G049400 207 / 4e-70 AT5G28060 222 / 3e-76 Ribosomal protein S24e family protein (.1)
Potri.013G036100 205 / 2e-69 AT5G28060 225 / 1e-77 Ribosomal protein S24e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01282 Ribosomal_S24e Ribosomal protein S24e
Representative CDS sequence
>Lus10004123 pacid=23157521 polypeptide=Lus10004123 locus=Lus10004123.g ID=Lus10004123.BGIv1.0 annot-version=v1.0
ATGGTGTCGGAGAAGCTCGGTTCTGGGATCACCATCCGCACCCGCAAGTTCATGACCAACCGTCTCCTCTCCAGGAAGCAGTTCGTTATTGAGGTTCTCC
ATCCAGGAAAGGCCAATGTTCCCAAGGCTGAAATCAAGGCTATGTTGGCGACATTGTACTCTGTCAGGGATGAAAATGCTATCTTTGTGTTCAAGTTCAG
GACCCACTTTGGAGGGGGAAAGTCTACTGGCTTTGGGCTGATTTATGATTCAGTTGAGAATGCCAAGAAGTTTGAGCCTAAGTACAGACTGATCAGGAAT
GGACTTGATACCAAGGTTGAGAAGTCAAGGAAGCAGATGAAGGAACGCAAGAACAGGTCAAAGAAGATCCGTGGTGTAAAGAAGACCAAGGCTGGAGATG
CTGCCAAGGGTGGAAAGAAGAAGTGA
AA sequence
>Lus10004123 pacid=23157521 polypeptide=Lus10004123 locus=Lus10004123.g ID=Lus10004123.BGIv1.0 annot-version=v1.0
MVSEKLGSGITIRTRKFMTNRLLSRKQFVIEVLHPGKANVPKAEIKAMLATLYSVRDENAIFVFKFRTHFGGGKSTGFGLIYDSVENAKKFEPKYRLIRN
GLDTKVEKSRKQMKERKNRSKKIRGVKKTKAGDAAKGGKKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G28060 Ribosomal protein S24e family ... Lus10004123 0 1
AT1G36240 Ribosomal protein L7Ae/L30e/S1... Lus10016431 1.0 0.9162
AT4G09800 RPS18C S18 ribosomal protein (.1) Lus10006914 3.2 0.9046
AT3G10950 Zinc-binding ribosomal protein... Lus10011359 3.2 0.8815
AT3G49010 RSU2, ATBBC1 40S RIBOSOMAL PROTEIN, breast ... Lus10020398 3.5 0.8911
AT2G19740 Ribosomal protein L31e family ... Lus10018032 4.0 0.8862
AT3G16780 Ribosomal protein L19e family ... Lus10023387 4.9 0.8796
AT3G22660 rRNA processing protein-relate... Lus10031120 5.9 0.8760
AT3G05560 Ribosomal L22e protein family ... Lus10006509 6.9 0.8754
AT1G17880 ATBTF3 basic transcription factor 3 (... Lus10031551 7.1 0.8705
AT1G60080 3'-5'-exoribonuclease family p... Lus10021789 8.1 0.8487

Lus10004123 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.