Lus10004139 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G08830 254 / 3e-88 CSD1 copper/zinc superoxide dismutase 1 (.1.2)
AT5G18100 200 / 9e-67 CSD3 copper/zinc superoxide dismutase 3 (.1.2)
AT2G28190 194 / 6e-64 CZSOD2, CSD2 copper/zinc superoxide dismutase 2 (.1)
AT1G12520 57 / 2e-10 ATCCS, CCS1 copper chaperone for SOD1 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001719 283 / 5e-98 AT1G08830 250 / 6e-85 copper/zinc superoxide dismutase 1 (.1.2)
Lus10016155 197 / 7e-65 AT2G28190 308 / 1e-107 copper/zinc superoxide dismutase 2 (.1)
Lus10021410 190 / 8e-62 AT2G28190 306 / 5e-107 copper/zinc superoxide dismutase 2 (.1)
Lus10010651 191 / 9e-61 AT5G18100 228 / 9e-75 copper/zinc superoxide dismutase 3 (.1.2)
Lus10013615 174 / 1e-54 AT5G18100 209 / 7e-68 copper/zinc superoxide dismutase 3 (.1.2)
Lus10006686 62 / 4e-12 AT1G12520 393 / 6e-138 copper chaperone for SOD1 (.1.2.3)
Lus10007031 62 / 7e-12 AT1G12520 399 / 5e-140 copper chaperone for SOD1 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G044400 273 / 7e-96 AT1G08830 266 / 5e-93 copper/zinc superoxide dismutase 1 (.1.2)
Potri.013G031100 262 / 2e-91 AT1G08830 261 / 6e-91 copper/zinc superoxide dismutase 1 (.1.2)
Potri.013G056900 204 / 2e-68 AT5G18100 239 / 4e-82 copper/zinc superoxide dismutase 3 (.1.2)
Potri.019G035800 202 / 6e-68 AT5G18100 237 / 3e-81 copper/zinc superoxide dismutase 3 (.1.2)
Potri.004G216700 201 / 2e-66 AT2G28190 267 / 2e-91 copper/zinc superoxide dismutase 2 (.1)
Potri.009G005100 191 / 1e-62 AT2G28190 252 / 2e-85 copper/zinc superoxide dismutase 2 (.1)
Potri.003G118400 57 / 5e-10 AT1G12520 393 / 8e-138 copper chaperone for SOD1 (.1.2.3)
Potri.001G113800 53 / 7e-09 AT1G12520 377 / 2e-131 copper chaperone for SOD1 (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Representative CDS sequence
>Lus10004139 pacid=23157515 polypeptide=Lus10004139 locus=Lus10004139.g ID=Lus10004139.BGIv1.0 annot-version=v1.0
ATGGTGAAGGCAGTTGCAGTCCTTGGAAACAGTGATGGCGTCAGTGGCACCATCTTCTTCAGTCAGGAAGGCGATGTTCCAACCACTGTAACTGGAAACA
TCTCTGGCCTTAAGCCAGGACTCCATGGCTTCCATGTCCACGCCCTTGGTGACACCACTAACGGCTGCATGTCCACTGGACCCCACTTCAACCCTCAAGG
AAAGGAACACGGTGCTCCTGAGGATGAACACCGCCATGCCGGTGACCTTGGAAACGTTACCGTTGGAGATGATGGTACTGCCACTTTCACCATCATTGAC
AAGCATATTCCTCTCACCGGTGCAAACTCCATCATCGGCAGGGCTGTTGTTGTTCATGCCGATCCTGATGACCTTGGAAAGGGTGGACACGAGCTGAGCA
AAAGCACTGGCAATGCAGGAGGAAGAGTTGCCTGCGGTATCATCGGAATGCAAGCTTAA
AA sequence
>Lus10004139 pacid=23157515 polypeptide=Lus10004139 locus=Lus10004139.g ID=Lus10004139.BGIv1.0 annot-version=v1.0
MVKAVAVLGNSDGVSGTIFFSQEGDVPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTGPHFNPQGKEHGAPEDEHRHAGDLGNVTVGDDGTATFTIID
KHIPLTGANSIIGRAVVVHADPDDLGKGGHELSKSTGNAGGRVACGIIGMQA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G08830 CSD1 copper/zinc superoxide dismuta... Lus10004139 0 1
AT5G47870 RAD52-2B, RAD52... radiation sensitive 51-2, unkn... Lus10002565 1.0 0.9488
AT2G26920 Ubiquitin-associated/translati... Lus10026781 2.8 0.9386
AT3G02430 Protein of unknown function (D... Lus10012734 3.6 0.9271
AT3G02790 C2H2ZnF zinc finger (C2H2 type) family... Lus10036432 5.5 0.9263
AT1G11320 unknown protein Lus10013574 5.7 0.9394
AT1G65930 cICDH cytosolic NADP+-dependent isoc... Lus10020798 5.8 0.9435
AT3G50300 HXXXD-type acyl-transferase fa... Lus10031725 6.2 0.9238
AT3G22110 PAC1 20S proteasome alpha subunit C... Lus10004236 6.7 0.9071
AT4G00860 AT0ZI1, ATOZI1 Arabidopsis thaliana ozone-ind... Lus10007542 7.0 0.9317
AT5G25940 early nodulin-related (.1) Lus10002236 8.4 0.9119

Lus10004139 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.