Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18310 41 / 6e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013995 [exp] 81 / 1e-18 AT2G17030 52 / 6e-07 F-box family protein with a domain of unknown function (DUF295) (.1) Lus10008665 [exp] 64 / 1e-12 AT5G55150 63 / 9e-11 Protein of unknown function (DUF295) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G134900 [exp] 40 / 0.0003 AT4G17565 99 / 8e-23 F-box family protein with a domain of unknown function (DUF295) (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004148 pacid=23157523 polypeptide=Lus10004148 locus=Lus10004148.g ID=Lus10004148.BGIv1.0 annot-version=v1.0 ATGAACAAGCAGCCTTCTGACTACCTCGAGTCTATACAACGTCGCACAAGACCGACTTATCGACTCCAAACTTGGAGTGAAGTTCCAGACGGTAAAAGAA TATCCGGGGCATCACGTGGCTGGCTTATTTTCGCAGAAAAAGAGCATGAGATCATCACGCTCTTCAATCGTTTCACTCAAGCTCAGATTTCTCTCCCTCC AATCACCGCCGACCAGAGCAGCCATCCAAATTTGGTCGAGAAGGCGATCTTATCCGCGGATCCTTATCTTCATCGGAACGATTATGTAGTAGCGGCCTTC ATCGCCAACTCAAATCTTCTGGCTCTGTTCAAACGGGGTTACGGAGGAGATGGAAGATGGAGGACCCTCGAATCGCGGGTGGACAAGTAA
AA sequence Show only first row Show all	>Lus10004148 pacid=23157523 polypeptide=Lus10004148 locus=Lus10004148.g ID=Lus10004148.BGIv1.0 annot-version=v1.0 MNKQPSDYLESIQRRTRPTYRLQTWSEVPDGKRISGASRGWLIFAEKEHEIITLFNRFTQAQISLPPITADQSSHPNLVEKAILSADPYLHRNDYVVAAF IANSNLLALFKRGYGGDGRWRTLESRVDK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10004148 [exp]	0	1
AT5G45550		MOB1-like	MOB1-like, Mob1/phocein family...		Lus10021556 [exp]	1.4	0.9173
AT1G14040			EXS (ERD1/XPR1/SYG1) family pr...		Lus10036782 [exp]	5.3	0.8984
AT3G04970			DHHC-type zinc finger family p...		Lus10004149 [exp]	6.9	0.8934
AT2G16750			Protein kinase protein with ad...		Lus10025103 [exp]	10.7	0.8171
AT1G04240	AUX_IAA	IAA3, SHY2	SHORT HYPOCOTYL 2, indole-3-ac...		Lus10039413 [exp]	12.7	0.8077
AT1G07540	MYB	TRFL2	TRF-like 2 (.1)		Lus10040795 [exp]	15.9	0.8243
AT3G27210			unknown protein		Lus10035217 [exp]	16.7	0.8421
AT5G58110			chaperone binding;ATPase activ...		Lus10040580 [exp]	16.7	0.8317
AT5G47060			Protein of unknown function (D...		Lus10043343 [exp]	21.7	0.8572
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10013924 [exp]	26.6	0.8957

Compare expression of checked genes

Lus10004148 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.