Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G20330 126 / 1e-36 FRL1, CVP1, SMT2 FRILL1, COTYLEDON VASCULAR PATTERN 1, sterol methyltransferase 2 (.1) AT1G76090 122 / 3e-35 SMT3 sterol methyltransferase 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005625 [exp] 139 / 1e-41 AT1G20330 582 / 0.0 FRILL1, COTYLEDON VASCULAR PATTERN 1, sterol methyltransferase 2 (.1) Lus10023995 [exp] 103 / 2e-28 AT1G20330 459 / 9e-164 FRILL1, COTYLEDON VASCULAR PATTERN 1, sterol methyltransferase 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G245800 [exp] 129 / 9e-38 AT1G20330 667 / 0.0 FRILL1, COTYLEDON VASCULAR PATTERN 1, sterol methyltransferase 2 (.1) Potri.002G016300 [exp] 124 / 9e-36 AT1G20330 647 / 0.0 FRILL1, COTYLEDON VASCULAR PATTERN 1, sterol methyltransferase 2 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004158 pacid=23153324 polypeptide=Lus10004158 locus=Lus10004158.g ID=Lus10004158.BGIv1.0 annot-version=v1.0 ATGGAGTCCCTCGCTCTCCTCTTCACCGGCGGCGCACTCCTCGCCGCTGCCGTCTACTGGTTCGTCTGCATTTTGGATCCTGCCGAGCAGAAGGGTAAAC GCGCCGTCGATCTCTCCGCTGGCTCATTCTCCGCCGACCAAGTCCATGACAACTACAAACAATACTTGTCTTTCTTTCGCCTCCCAAAAGAGATCAACAA CGCCGACAAAGTTCCCGACGTCGTCGACACGTTCTACAACCTTGTTACGGATATTTACGAGTGGGGGTAG
AA sequence Show only first row Show all	>Lus10004158 pacid=23153324 polypeptide=Lus10004158 locus=Lus10004158.g ID=Lus10004158.BGIv1.0 annot-version=v1.0 MESLALLFTGGALLAAAVYWFVCILDPAEQKGKRAVDLSAGSFSADQVHDNYKQYLSFFRLPKEINNADKVPDVVDTFYNLVTDIYEWG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G20330		FRL1, CVP1, SMT...	FRILL1, COTYLEDON VASCULAR PAT...		Lus10004158 [exp]	0	1
					Lus10000984 [exp]	1.0	1.0000
AT3G05550			Hypoxia-responsive family prot...		Lus10031490 [exp]	2.0	1.0000
					Lus10017835 [exp]	2.4	1.0000
					Lus10040014 [exp]	2.8	1.0000
AT3G23350			ENTH/VHS family protein (.1)		Lus10021173 [exp]	3.2	1.0000
AT1G06770		DRIP1	DREB2A-interacting protein 1 (...		Lus10042532 [exp]	3.5	1.0000
AT5G44400			FAD-binding Berberine family p...		Lus10027162 [exp]	3.7	1.0000
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10005439 [exp]	4.0	1.0000
					Lus10032805 [exp]	4.2	1.0000
					Lus10018912 [exp]	4.5	1.0000

Compare expression of checked genes

Lus10004158 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.