Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39235 110 / 3e-33 unknown protein AT3G05570 107 / 4e-32 unknown protein AT2G21640 81 / 3e-21 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021065 [exp] 167 / 7e-56 AT4G39235 113 / 2e-34 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G057100 [exp] 115 / 3e-35 AT4G39235 122 / 3e-38 unknown protein Potri.004G155500 [exp] 112 / 4e-34 AT4G39235 120 / 2e-37 unknown protein Potri.005G205500 [exp] 95 / 5e-27 AT4G39235 106 / 1e-31 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004160 pacid=23153331 polypeptide=Lus10004160 locus=Lus10004160.g ID=Lus10004160.BGIv1.0 annot-version=v1.0 ATGGAGGCATCAAAAGGATCGGAGGAAAAGCAGAAGCAACCAAAGCCAGTAGAATCATGCCGCAAGTACAAGAAGGACGACGCCAGTTTTCTGGAAGACG TGAAAGATCACATCGACGAGTTCATCAACGCATCGATGGACGAGCACAAGTCTTGCTTTAAGAAAACCATCAATAAGATGTTTAGCATGACGAGGATTGT TGAGAAGAAGCAAGCCGAAGCTGAAGGCGTCGAAAGTGTTCTCCCCCTTCAAACTAGCGTGTCTAAATGA
AA sequence Show only first row Show all	>Lus10004160 pacid=23153331 polypeptide=Lus10004160 locus=Lus10004160.g ID=Lus10004160.BGIv1.0 annot-version=v1.0 MEASKGSEEKQKQPKPVESCRKYKKDDASFLEDVKDHIDEFINASMDEHKSCFKKTINKMFSMTRIVEKKQAEAEGVESVLPLQTSVSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39235			unknown protein		Lus10004160 [exp]	0	1
AT5G42300		UBL5	ubiquitin-like protein 5 (.1)		Lus10023188 [exp]	1.4	0.9050
AT4G08230			glycine-rich protein (.1.2)		Lus10024100 [exp]	2.4	0.8843
AT3G26980		MUB4	membrane-anchored ubiquitin-fo...		Lus10032014 [exp]	3.7	0.8114
AT3G57090		FIS1A, BIGYIN	FISSION 1A, Tetratricopeptide ...		Lus10009706 [exp]	3.9	0.8514
AT3G26980		MUB4	membrane-anchored ubiquitin-fo...		Lus10041539 [exp]	5.5	0.8380
AT3G14430			unknown protein		Lus10030201 [exp]	6.3	0.8022
AT3G23610		DSPTP1	dual specificity protein phosp...		Lus10041227 [exp]	6.8	0.7787
AT1G52740		HTA9	histone H2A protein 9 (.1)		Lus10019449 [exp]	7.2	0.8123
AT5G42850			Thioredoxin superfamily protei...		Lus10037477 [exp]	7.7	0.8247
AT5G61310			Cytochrome c oxidase subunit V...		Lus10001454 [exp]	8.5	0.8184

Compare expression of checked genes

Lus10004160 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.