Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66160 75 / 7e-17 ATCMPG1 "CYS, MET, PRO, and GLY protein 1", CYS, MET, PRO, and GLY protein 1 (.1.2) AT5G37490 66 / 1e-13 ARM repeat superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021822 [exp] 174 / 1e-57 AT3G02840 59 / 7e-17 ARM repeat superfamily protein (.1) Lus10001079 [exp] 171 / 2e-52 AT5G37490 290 / 1e-93 ARM repeat superfamily protein (.1) Lus10040124 [exp] 116 / 9e-34 AT1G66160 154 / 6e-45 "CYS, MET, PRO, and GLY protein 1", CYS, MET, PRO, and GLY protein 1 (.1.2) Lus10016166 [exp] 44 / 1e-05 AT3G52450 462 / 2e-161 plant U-box 22 (.1) Lus10021267 [exp] 42 / 3e-05 AT2G35930 474 / 5e-167 plant U-box 23 (.1) Lus10040125 [exp] 42 / 4e-05 AT3G02840 164 / 1e-48 ARM repeat superfamily protein (.1) Lus10029393 [exp] 40 / 0.0002 AT3G52450 462 / 1e-161 plant U-box 22 (.1) Lus10000800 [exp] 39 / 0.0003 AT3G11840 293 / 7e-95 plant U-box 24 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G042600 [exp] 110 / 1e-29 AT5G37490 294 / 2e-95 ARM repeat superfamily protein (.1) Potri.015G031000 [exp] 103 / 4e-27 AT5G37490 323 / 9e-107 ARM repeat superfamily protein (.1) Potri.017G135000 [exp] 88 / 3e-21 AT5G37490 375 / 4e-127 ARM repeat superfamily protein (.1) Potri.004G083900 [exp] 82 / 2e-19 AT5G37490 354 / 8e-119 ARM repeat superfamily protein (.1) Potri.008G137700 [exp] 72 / 8e-16 AT5G37490 333 / 9e-111 ARM repeat superfamily protein (.1) Potri.010G103100 [exp] 68 / 3e-14 AT5G37490 315 / 1e-103 ARM repeat superfamily protein (.1) Potri.016G069400 [exp] 49 / 1e-07 AT3G52450 511 / 0.0 plant U-box 22 (.1) Potri.009G016200 [exp] 49 / 2e-07 AT2G35930 475 / 4e-167 plant U-box 23 (.1) Potri.009G100200 [exp] 42 / 2e-05 AT1G49780 515 / 0.0 plant U-box 26 (.1) Potri.009G016100 [exp] 41 / 6e-05 AT3G11840 326 / 6e-108 plant U-box 24 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004189 pacid=23153311 polypeptide=Lus10004189 locus=Lus10004189.g ID=Lus10004189.BGIv1.0 annot-version=v1.0 ATGATTCAAGACTTGTGCGTTCAGAGCGGCAGATTCCGCGTCGAGAAAATCTTTACTCCCAGAGTCCCTGTTTCCTCCTCTCAAATCTCTGTCGTCCTCC GGTTGGAGGATTCTACCGCGAGATCGAACGTATCGGAGACCTTGGACTCCTTGCGTAAGATTAACAGTTGGGGGAACGAGAGCGAGAGGAATCGATTGTG TATTGTCTCCGTTAGAGCCTCCGCCGTCCTTGCAACTGCGTTCGACGGATTTGCCGTCAGAGTACTTGAGCAGCTACTAGCTTCGATTAGCTGGATGCTT CCCATCATCGACGCTGAAGCTCTCGGGCGATTGGGATCGCCGGAGTCGGTGAAAGCACTAGTCTAA
AA sequence Show only first row Show all	>Lus10004189 pacid=23153311 polypeptide=Lus10004189 locus=Lus10004189.g ID=Lus10004189.BGIv1.0 annot-version=v1.0 MIQDLCVQSGRFRVEKIFTPRVPVSSSQISVVLRLEDSTARSNVSETLDSLRKINSWGNESERNRLCIVSVRASAVLATAFDGFAVRVLEQLLASISWML PIIDAEALGRLGSPESVKALV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G66160		ATCMPG1	"CYS, MET, PRO, and GLY protei...		Lus10004189 [exp]	0	1
AT5G06790			unknown protein		Lus10023815 [exp]	9.5	0.6938
					Lus10027245 [exp]	27.7	0.5649
AT3G22680		RDM1	RNA-DIRECTED DNA METHYLATION 1...		Lus10006598 [exp]	40.2	0.5861
AT1G08790			Protein of unknown function (D...		Lus10042536 [exp]	45.5	0.5432
AT2G40070			unknown protein		Lus10002493 [exp]	63.4	0.5497
AT1G07745		SSN1, ATRAD51D,...	SUPPRESOR OF SNI1, homolog of ...		Lus10037642 [exp]	92.5	0.5354
					Lus10038468 [exp]	110.9	0.5332
AT5G44450			methyltransferases (.1)		Lus10028142 [exp]	151.5	0.4586
AT1G27170			transmembrane receptors;ATP bi...		Lus10014582 [exp]	160.7	0.5047
AT3G59680			unknown protein		Lus10027060 [exp]	202.8	0.4848

Compare expression of checked genes

Lus10004189 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.