Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11670 0 / 1 DGD1 DIGALACTOSYL DIACYLGLYCEROL DEFICIENT 1, UDP-Glycosyltransferase superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004200 [exp] 52 / 2e-09 AT3G11670 984 / 0.0 DIGALACTOSYL DIACYLGLYCEROL DEFICIENT 1, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10013576 [exp] 43 / 3e-06 AT3G11670 546 / 0.0 DIGALACTOSYL DIACYLGLYCEROL DEFICIENT 1, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10021273 [exp] 43 / 3e-06 AT3G11670 1127 / 0.0 DIGALACTOSYL DIACYLGLYCEROL DEFICIENT 1, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10029403 [exp] 0 / 1 AT3G11670 803 / 0.0 DIGALACTOSYL DIACYLGLYCEROL DEFICIENT 1, UDP-Glycosyltransferase superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G070200 [exp] 43 / 2e-06 AT3G11670 1118 / 0.0 DIGALACTOSYL DIACYLGLYCEROL DEFICIENT 1, UDP-Glycosyltransferase superfamily protein (.1.2) Potri.006G203200 [exp] 42 / 3e-06 AT3G11670 1117 / 0.0 DIGALACTOSYL DIACYLGLYCEROL DEFICIENT 1, UDP-Glycosyltransferase superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004199 pacid=23175387 polypeptide=Lus10004199 locus=Lus10004199.g ID=Lus10004199.BGIv1.0 annot-version=v1.0 ATGCGCGCCAGGGCGAACTCGTTCAAGAACCTGGCGTCTTCCTTCGACCGCGAGCTAGAGAACTTCTTCAGCTCCGCGTCGACGACGTTCGTCTCGTCTT CCGTCGGAGAATGTGTTCGTGAAGAAGCTCCAGCCGAAGATTTCGGAGCTGCGGAGAGTGTACTCGGCGCCGGAGATAAGTAA
AA sequence Show only first row Show all	>Lus10004199 pacid=23175387 polypeptide=Lus10004199 locus=Lus10004199.g ID=Lus10004199.BGIv1.0 annot-version=v1.0 MRARANSFKNLASSFDRELENFFSSASTTFVSSSVGECVREEAPAEDFGAAESVLGAGDK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10004199 [exp]	0	1
AT4G05090			Inositol monophosphatase famil...		Lus10007817 [exp]	3.5	0.8809
AT4G34830		PDE346, MRL1	PIGMENT DEFECTIVE 346, MATURAT...		Lus10012180 [exp]	10.9	0.8625
AT2G23180		CYP96A1	"cytochrome P450, family 96, s...		Lus10022279 [exp]	11.7	0.8335
AT5G35220		EGY1	ETHYLENE-DEPENDENT GRAVITROPIS...		Lus10020304 [exp]	12.5	0.8507
AT3G57800	bHLH	bHLH060	basic helix-loop-helix (bHLH) ...		Lus10011307 [exp]	16.4	0.8119
AT5G08650			Small GTP-binding protein (.1)		Lus10025694 [exp]	17.1	0.8457
AT2G45660	MADS	ATSOC1, SOC1, A...	SUPPRESSOR OF OVEREXPRESSION O...		Lus10036542 [exp]	22.2	0.8226
AT4G01800		AtcpSecA, AGY1,...	Arabidopsis thaliana chloropla...		Lus10038031 [exp]	23.6	0.8416
AT5G24300		SSI1, SSI, ATSS...	STARCH SYNTHASE 1, Glycogen/st...		Lus10022398 [exp]	26.8	0.8205
AT2G41220		GLU2	glutamate synthase 2 (.1)		Lus10003820 [exp]	28.2	0.8219

Compare expression of checked genes

Lus10004199 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.