Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G44350 67 / 2e-13 NAC ANAC061 NAC domain containing protein 61 (.1.2) AT5G22380 67 / 2e-13 NAC ANAC090 NAC domain containing protein 90 (.1) AT3G15510 50 / 4e-07 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) AT3G18400 47 / 3e-06 NAC ANAC058 NAC domain containing protein 58 (.1) AT5G61430 46 / 6e-06 NAC ANAC100, ATNAC5 NAC domain containing protein 100 (.1) AT5G07680 46 / 7e-06 NAC ANAC079, ATNAC4, ANAC080 Arabidopsis NAC domain containing protein 79, NAC domain containing protein 80 (.1.2) AT5G18270 46 / 7e-06 NAC ANAC087 Arabidopsis NAC domain containing protein 87 (.1.2) AT1G33060 46 / 8e-06 NAC ANAC014 NAC 014 (.1.2) AT3G29035 46 / 8e-06 NAC ORS1, AtNAC3, ANAC059 ORE1 SISTER1, Arabidopsis NAC domain containing protein 59, NAC domain containing protein 3 (.1) AT5G53950 46 / 9e-06 NAC ATCUC2, CUC2, ANAC098 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029410 [exp] 149 / 3e-44 AT5G22380 171 / 1e-52 NAC domain containing protein 90 (.1) Lus10004846 [exp] 67 / 4e-13 AT5G22380 275 / 1e-93 NAC domain containing protein 90 (.1) Lus10020643 [exp] 66 / 7e-13 AT5G22380 283 / 1e-96 NAC domain containing protein 90 (.1) Lus10043095 [exp] 52 / 1e-07 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10032657 [exp] 51 / 2e-07 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10032919 [exp] 48 / 2e-06 AT5G24590 314 / 7e-102 Arabidopsis NAC domain containing protein 91, TCV-interacting protein (.2) Lus10015587 [exp] 48 / 2e-06 AT5G24590 306 / 9e-99 Arabidopsis NAC domain containing protein 91, TCV-interacting protein (.2) Lus10030723 [exp] 47 / 3e-06 AT1G76420 243 / 1e-77 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10019926 [exp] 47 / 3e-06 AT1G61110 243 / 4e-78 NAC domain containing protein 25 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G076100 [exp] 86 / 3e-20 AT5G22380 214 / 2e-69 NAC domain containing protein 90 (.1) Potri.006G209200 [exp] 86 / 5e-20 AT5G22380 241 / 3e-80 NAC domain containing protein 90 (.1) Potri.016G076000 [exp] 79 / 1e-17 AT5G22380 226 / 4e-74 NAC domain containing protein 90 (.1) Potri.001G218800 [exp] 67 / 3e-13 AT5G22380 272 / 3e-92 NAC domain containing protein 90 (.1) Potri.009G019200 [exp] 66 / 1e-12 AT3G44350 257 / 1e-86 NAC domain containing protein 61 (.1.2) Potri.004G038000 [exp] 56 / 3e-09 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.013G054000 [exp] 53 / 3e-08 AT3G04070 338 / 9e-115 NAC domain containing protein 47 (.1.2) Potri.011G046700 [exp] 53 / 3e-08 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.018G095000 [exp] 52 / 1e-07 AT1G01720 187 / 3e-56 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.002G178700 [exp] 51 / 2e-07 AT2G46770 366 / 1e-125 NAC SECONDARY WALL THICKENING PROMOTING FACTOR1, Arabidopsis NAC domain containing protein 43, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10004206 pacid=23175394 polypeptide=Lus10004206 locus=Lus10004206.g ID=Lus10004206.BGIv1.0 annot-version=v1.0 ATGGCGTTTCATTTCTCTGCGCAGAACTGTCAGCAGGCAGAGATCGGGCGTCGTTGGAGGAAGGGGAAGATCAGCAGTGGTTCTTCTTTAGGAGGATGCA AGAGAGGGAAGGAAGAGGAGGGAGGCCGTAGCGGGTTGCTGGGTGCGGGTATTGGAAAGCCACGGGTTCACTTGGCTACGTCTACAGCAGTAGTAGTACT GATCATCAACGTCGAAGTTGCATTGGGGGAGAAAAGGACGATGGTGTTCTACAAAGGCAAAGCCCCCAAAGGCCGCAAAACCCATTGGAAGATTCACGAG TACAAGGCCTTCGTCAATCCCCAACATCAACAACAACAACAGCAACAATCTCTGCAGCTGAGGCACGAGTACAGTTTGATTCGGTTGTACAAGAAGTCCA GATGCTTGAGATCATTGGACAGAAGGCCGGTTGGGATATTTCAGCTGCAACCGATTAGTACCACCTCTACTACAGCAAGTACTAGTACTGCTCATAGTCA TACCAATAATCAATTACTACTCAATATAACTACTCCACCTGCAGATCAACAAGCTGACAGGAATGATGATGATGCTGCTGCTGCTAATCATCGTGATCGC GAACCTTCGGGATTCTGGGGTTACTTGCAGGAACTTGACCTGCATTTCAATGGAGACGATAATCTCTAA
AA sequence Show only first row Show all	>Lus10004206 pacid=23175394 polypeptide=Lus10004206 locus=Lus10004206.g ID=Lus10004206.BGIv1.0 annot-version=v1.0 MAFHFSAQNCQQAEIGRRWRKGKISSGSSLGGCKRGKEEEGGRSGLLGAGIGKPRVHLATSTAVVVLIINVEVALGEKRTMVFYKGKAPKGRKTHWKIHE YKAFVNPQHQQQQQQQSLQLRHEYSLIRLYKKSRCLRSLDRRPVGIFQLQPISTTSTTASTSTAHSHTNNQLLLNITTPPADQQADRNDDDAAAANHRDR EPSGFWGYLQELDLHFNGDDNL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G44350	NAC	ANAC061	NAC domain containing protein ...		Lus10004206 [exp]	0	1
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10001776 [exp]	19.2	0.7588
AT5G05320			FAD/NAD(P)-binding oxidoreduct...		Lus10016392 [exp]	26.4	0.7747
AT4G37530			Peroxidase superfamily protein...		Lus10011079 [exp]	41.7	0.7873
AT5G25940			early nodulin-related (.1)		Lus10033027 [exp]	42.0	0.7122
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Lus10001775 [exp]	44.2	0.7839
AT5G06080	AS2	LBD33	LOB domain-containing protein ...		Lus10004707 [exp]	52.9	0.7795
AT1G73990		SPPA1, SPPA	signal peptide peptidase (.1)		Lus10013334 [exp]	130.0	0.7309
AT5G10050			NAD(P)-binding Rossmann-fold s...		Lus10019684 [exp]	283.2	0.7060

Compare expression of checked genes

Lus10004206 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.