Lus10004212 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G44260 325 / 2e-112 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G22250 319 / 6e-110 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT2G32070 266 / 4e-89 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G10960 261 / 3e-87 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G80780 251 / 3e-83 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT1G15920 247 / 1e-81 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
AT1G06450 125 / 1e-33 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G61470 114 / 4e-30 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 106 / 6e-27 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44240 100 / 6e-25 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016980 437 / 6e-155 AT5G22250 332 / 8e-114 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10021304 434 / 9e-155 AT5G22250 335 / 8e-116 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10034180 326 / 2e-112 AT5G22250 410 / 4e-146 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10018330 264 / 3e-88 AT2G32070 444 / 3e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017123 264 / 5e-88 AT2G32070 447 / 1e-160 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10003635 257 / 2e-85 AT2G32070 435 / 6e-156 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10036291 256 / 4e-85 AT2G32070 432 / 9e-155 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10029417 232 / 1e-77 AT5G22250 164 / 2e-51 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10029416 180 / 2e-57 AT3G44260 105 / 4e-29 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G205600 367 / 2e-128 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G073000 351 / 3e-122 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.004G200400 330 / 3e-114 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.009G161500 326 / 1e-112 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G046700 274 / 3e-92 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G187200 268 / 6e-90 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 268 / 8e-90 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.018G020900 261 / 3e-87 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G262500 259 / 2e-86 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G040400 240 / 4e-79 AT5G22250 253 / 4e-84 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF04857 CAF1 CAF1 family ribonuclease
Representative CDS sequence
>Lus10004212 pacid=23175406 polypeptide=Lus10004212 locus=Lus10004212.g ID=Lus10004212.BGIv1.0 annot-version=v1.0
ATGTCCGTTGACAAATCCCGCCTCGTCGCTTCGGCCGGACGACCGGTGGTGACCCGATCGGTGTGGGCGGAGAATTTGGAGTCCGAGTTCGCCGTCATCA
TCTCCGTTGCCAAGGAATATCCGCTGATATCCATGGATACGGAGTTCCCCGGCGTGGTCATACGGCCACCGGGAGTCGAGCAGGCCAACATCCGGCTTCA
AGATCCGACGGCGCGGTACGCGAGCCTAAAGGCCAACGTCGATTCGCTCAAACTGATCCAGGTAGGGCTCACCGTAGCCGACCGAGACGGCAATCTACCG
GATCTTGGCGGCGATAGCTGCTACATCTGGGAGTTCAACTTTAGGGATTTTGACGTCACTTGCGACGATCACTCCCACGACTCCGTCGATCTACTGAGGA
GGCAAGGGATCGATTTCGAGAAGAATCGCAAGGACGGAATCCAGGCGGTGAAATTCGCAGAGCTGCTGATGACTTCCGGGCTGGTCCTGAACGATTCGGT
CAGCTGGGTGACGTTCCACAGCGCTTACGACTTTGGTTACCTGGTCAAGTGTCTGACTCAGCGGCCTTTGCCGGACAGATTGGACGATTTCCTCGATATT
GTGAGGATGTTCTTCGGGGCTAGGGTTTACGATGTGAAGCATCTGATGAAGTTTGGGGCGAATTTGTATGGCGGATTGGACAGGACGTGCACCACTCTGG
GTGTGAAGAGGGTTACTGGGAAGAGTCACCAAGCTGGCTCGGATAGTTTGGCCACCCTCCATGCTTTCCAGAAGATGAGAGAGATGTACTTCAGCGATGG
TGCAATGGAGAAGTACGCCAATGTGCTATACGGGTTAGAACTGTTGGCTTCATAA
AA sequence
>Lus10004212 pacid=23175406 polypeptide=Lus10004212 locus=Lus10004212.g ID=Lus10004212.BGIv1.0 annot-version=v1.0
MSVDKSRLVASAGRPVVTRSVWAENLESEFAVIISVAKEYPLISMDTEFPGVVIRPPGVEQANIRLQDPTARYASLKANVDSLKLIQVGLTVADRDGNLP
DLGGDSCYIWEFNFRDFDVTCDDHSHDSVDLLRRQGIDFEKNRKDGIQAVKFAELLMTSGLVLNDSVSWVTFHSAYDFGYLVKCLTQRPLPDRLDDFLDI
VRMFFGARVYDVKHLMKFGANLYGGLDRTCTTLGVKRVTGKSHQAGSDSLATLHAFQKMREMYFSDGAMEKYANVLYGLELLAS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G44260 AtCAF1a CCR4- associated factor 1a, Po... Lus10004212 0 1
AT5G22250 AtCAF1b CCR4- associated factor 1b, Po... Lus10029417 1.0 0.9590
AT2G36780 UDP-Glycosyltransferase superf... Lus10012148 3.2 0.9470
AT5G10830 S-adenosyl-L-methionine-depend... Lus10024476 6.9 0.9358
AT3G09270 ATGSTU8 glutathione S-transferase TAU ... Lus10021103 8.2 0.9316
AT3G60870 AT-hook AHL18 AT-hook motif nuclear-localize... Lus10015862 8.8 0.9135
AT1G32440 PKP3 plastidial pyruvate kinase 3 (... Lus10011057 9.7 0.9294
AT2G04550 DSPTP1E, IBR5 DUAL SPECIFICITY PROTEIN PHOSP... Lus10000921 10.0 0.9053
AT4G33740 unknown protein Lus10020507 10.1 0.9282
AT2G24280 alpha/beta-Hydrolases superfam... Lus10017002 11.7 0.9111
AT2G20780 AtPLT4 Major facilitator superfamily ... Lus10018581 14.0 0.9029

Lus10004212 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.