Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01390 143 / 1e-45 AVMA10, VMA10 vacuolar membrane ATPase 10 (.1.2) AT4G23710 117 / 1e-35 VAG2 ,VATG2 ,VHA-G2 vacuolar ATP synthase subunit G2 (.1) AT4G25950 102 / 1e-29 VATG3 vacuolar ATP synthase G3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029418 [exp] 196 / 8e-67 AT3G01390 143 / 7e-46 vacuolar membrane ATPase 10 (.1.2) Lus10016977 [exp] 169 / 9e-56 AT3G01390 129 / 4e-40 vacuolar membrane ATPase 10 (.1.2) Lus10021301 [exp] 155 / 2e-50 AT4G23710 123 / 1e-37 vacuolar ATP synthase subunit G2 (.1) Lus10001543 [exp] 102 / 2e-29 AT4G25950 123 / 8e-38 vacuolar ATP synthase G3 (.1) Lus10009452 [exp] 100 / 7e-29 AT4G25950 123 / 7e-38 vacuolar ATP synthase G3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G222000 [exp] 161 / 9e-53 AT3G01390 147 / 2e-47 vacuolar membrane ATPase 10 (.1.2) Potri.008G040300 [exp] 160 / 3e-52 AT3G01390 145 / 2e-46 vacuolar membrane ATPase 10 (.1.2) Potri.019G080700 [exp] 110 / 1e-32 AT4G25950 120 / 8e-37 vacuolar ATP synthase G3 (.1) Potri.013G108300 [exp] 90 / 1e-24 AT3G01390 64 / 2e-14 vacuolar membrane ATPase 10 (.1.2) Potri.019G133701 [exp] 74 / 9e-19 AT4G25950 74 / 1e-18 vacuolar ATP synthase G3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0255 [flax] [poplar] ATP_synthase PF03179 [flax] [poplar] V-ATPase_G Vacuolar (H+)-ATPase G subunit
Representative CDS sequence Show only first row Show all	>Lus10004213 pacid=23175402 polypeptide=Lus10004213 locus=Lus10004213.g ID=Lus10004213.BGIv1.0 annot-version=v1.0 ATGGATTCAAGCAGGGGTCAGAATGGAATTCAACTTCTTCTAGCTGCAGAGCAAGAAGCTCAACACATTGTCAATGCTGCTAGAAACACAAAACTGGCCA GGCTGAAACAAGCCAAGGATGAGGCTGAAAAGGAAGCTGCTGAATTCCGTGCCCAAATGGAAGCTCAGTTCCAGAAAAAGCTCACAGATACCAGCGGCGA CTCGGGTGCCAACGTGAAGCGGCTGGAGCAAGAAACCGATATAAAGATCGGTGACTTGAAGACAGAGGCTTCCAGGATCTCTCAGGAAGTGGTACACATG CTTCTGAGGCATGTCACCACCGTTAAGAACTAG
AA sequence Show only first row Show all	>Lus10004213 pacid=23175402 polypeptide=Lus10004213 locus=Lus10004213.g ID=Lus10004213.BGIv1.0 annot-version=v1.0 MDSSRGQNGIQLLLAAEQEAQHIVNAARNTKLARLKQAKDEAEKEAAEFRAQMEAQFQKKLTDTSGDSGANVKRLEQETDIKIGDLKTEASRISQEVVHM LLRHVTTVKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G01390		AVMA10, VMA10	vacuolar membrane ATPase 10 (....		Lus10004213 [exp]	0	1
AT5G25450			Cytochrome bd ubiquinol oxidas...		Lus10008081 [exp]	1.7	0.8837
AT1G23750			Nucleic acid-binding, OB-fold-...		Lus10030871 [exp]	2.4	0.8714
AT3G07470			Protein of unknown function, D...		Lus10039620 [exp]	4.0	0.8368
AT1G12840		ATVHA-C, DET3	DE-ETIOLATED 3, ARABIDOPSIS TH...		Lus10031990 [exp]	4.9	0.8291
AT5G25450			Cytochrome bd ubiquinol oxidas...		Lus10013113 [exp]	6.5	0.8431
AT3G07470			Protein of unknown function, D...		Lus10029538 [exp]	8.4	0.8330
AT4G30960		CIPK6, SIP3, Sn...	SNF1-RELATED PROTEIN KINASE 3....		Lus10021852 [exp]	8.5	0.8180
AT1G67570			Protein of unknown function (D...		Lus10043011 [exp]	11.2	0.8266
AT1G64980			Nucleotide-diphospho-sugar tra...		Lus10005005 [exp]	11.2	0.8148
AT5G56170		LLG1	LORELEI-LIKE-GPI-ANCHORED PROT...		Lus10000404 [exp]	11.8	0.7802

Compare expression of checked genes

Lus10004213 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.