Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G36020 196 / 7e-64 HVA22J HVA22-like protein J (.1) AT5G42560 190 / 6e-61 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) AT1G75700 181 / 5e-59 HVA22G HVA22-like protein G (.1) AT1G19950 174 / 2e-54 HVA22H HVA22-like protein H (ATHVA22H) (.1) AT4G36720 60 / 2e-11 HVA22K HVA22-like protein K (.1) AT2G42820 59 / 2e-11 HVA22F HVA22-like protein F (.1) AT5G50720 52 / 3e-09 ATHVA22E ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) AT4G24960 51 / 1e-08 ATHVA22D ARABIDOPSIS THALIANA HVA22 HOMOLOGUE D, HVA22 homologue D (.1.2.3) AT1G74520 49 / 8e-08 ATHVA22A HVA22 homologue A (.1) AT5G62490 46 / 2e-06 ATHVA22B ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029419 [exp] 297 / 5e-104 AT2G36020 198 / 1e-63 HVA22-like protein J (.1) Lus10016974 [exp] 261 / 9e-90 AT2G36020 210 / 2e-68 HVA22-like protein J (.1) Lus10021299 [exp] 259 / 6e-89 AT2G36020 206 / 6e-67 HVA22-like protein J (.1) Lus10034519 [exp] 196 / 3e-63 AT5G42560 324 / 2e-111 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10033152 [exp] 196 / 3e-63 AT5G42560 328 / 7e-113 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10024332 [exp] 192 / 2e-61 AT5G42560 330 / 9e-114 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10007215 [exp] 61 / 5e-12 AT4G36720 196 / 2e-64 HVA22-like protein K (.1) Lus10010093 [exp] 60 / 2e-11 AT4G36720 202 / 2e-66 HVA22-like protein K (.1) Lus10032557 [exp] 57 / 8e-11 AT5G50720 172 / 8e-57 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G072600 [exp] 229 / 1e-77 AT2G36020 210 / 9e-69 HVA22-like protein J (.1) Potri.006G205300 [exp] 230 / 2e-77 AT2G36020 228 / 1e-74 HVA22-like protein J (.1) Potri.005G237900 [exp] 201 / 3e-65 AT5G42560 274 / 1e-91 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Potri.002G023500 [exp] 195 / 4e-63 AT5G42560 296 / 2e-100 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Potri.004G166800 [exp] 190 / 2e-61 AT1G75700 234 / 3e-78 HVA22-like protein G (.1) Potri.007G029300 [exp] 66 / 1e-13 AT4G36720 252 / 2e-85 HVA22-like protein K (.1) Potri.009G113400 [exp] 62 / 2e-12 AT4G36720 241 / 1e-81 HVA22-like protein K (.1) Potri.014G148600 [exp] 52 / 3e-09 AT5G62490 87 / 1e-22 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1) Potri.012G101600 [exp] 51 / 1e-08 AT5G50720 133 / 3e-41 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Potri.015G062800 [exp] 51 / 2e-08 AT1G74520 255 / 4e-88 HVA22 homologue A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03134 [flax] [poplar] TB2_DP1_HVA22 TB2/DP1, HVA22 family
Representative CDS sequence Show only first row Show all	>Lus10004215 pacid=23175404 polypeptide=Lus10004215 locus=Lus10004215.g ID=Lus10004215.BGIv1.0 annot-version=v1.0 ATGTTGGGAGATTTCTTGAACAGATTGCTCATGCTGTTTTTCGGGTATGCTTACCCGGCATTCGAATGCTTCAAGGTTGCTGAGAGGAACAAGATCAACA TCGAGGATATCCGGTTCTGGTGCCAATATTGGATCATTCTCGCACTGGTCACAGTTTGCGAAAGATTCGTCGACATTTTCCTGTGGTGGTTGCCGTTCTA TGGTGAGGCCAAGTTGGGATTCTTCATTTGGCTATGGTATCCAAAGACCAGGGGGACTTGCTTCATATTCAACAACTTCGTGAGGCCGTACGTTTCGAAA CACGAAACCGACATAGACAGGAAGTTGATGGAAGTGAAGGCCAGAGTTTGGGACTTTGCAATTTACTACTGGCAGAATTGCGCCAAGTTGGGTCAGTCCA CTTTCTTCCAGGTTCTCGAGCAGTTGGCTACTCAGTCCGGTCGGTTCGGCAATGTCAACACTAAGCCTCAGGTATTCGGTTAA
AA sequence Show only first row Show all	>Lus10004215 pacid=23175404 polypeptide=Lus10004215 locus=Lus10004215.g ID=Lus10004215.BGIv1.0 annot-version=v1.0 MLGDFLNRLLMLFFGYAYPAFECFKVAERNKINIEDIRFWCQYWIILALVTVCERFVDIFLWWLPFYGEAKLGFFIWLWYPKTRGTCFIFNNFVRPYVSK HETDIDRKLMEVKARVWDFAIYYWQNCAKLGQSTFFQVLEQLATQSGRFGNVNTKPQVFG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G36020		HVA22J	HVA22-like protein J (.1)		Lus10004215 [exp]	0	1
AT1G02790		PGA4	polygalacturonase 4 (.1)		Lus10003782 [exp]	1.7	0.9317
AT5G18960	FAR1_related	FRS12	FAR1-related sequence 12 (.1)		Lus10023137 [exp]	2.0	0.9026
					Lus10041665 [exp]	4.6	0.8656
					Lus10043281 [exp]	11.2	0.8037
AT2G27660			Cysteine/Histidine-rich C1 dom...		Lus10016256 [exp]	12.4	0.6993
AT4G25140		OLE1, OLEO1	oleosin 1 (.1)		Lus10031387 [exp]	13.3	0.7707
AT3G55700			UDP-Glycosyltransferase superf...		Lus10040244 [exp]	17.7	0.7059
AT4G01950		ATGPAT3, GPAT3	glycerol-3-phosphate acyltrans...		Lus10001449 [exp]	18.1	0.7950
AT2G21720			Plant protein of unknown funct...		Lus10010668 [exp]	24.5	0.8380
AT3G21090		ABCG15	ATP-binding cassette G15, ABC-...		Lus10035445 [exp]	25.4	0.7593

Compare expression of checked genes

Lus10004215 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.