Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14550 76 / 3e-18 Peroxidase superfamily protein (.1) AT1G14540 75 / 5e-18 Peroxidase superfamily protein (.1) AT5G05340 74 / 1e-17 Peroxidase superfamily protein (.1) AT4G36430 70 / 4e-16 Peroxidase superfamily protein (.1) AT2G18150 69 / 9e-16 Peroxidase superfamily protein (.1) AT2G38390 69 / 1e-15 Peroxidase superfamily protein (.1) AT5G06730 67 / 7e-15 Peroxidase superfamily protein (.1) AT2G38380 67 / 8e-15 Peroxidase superfamily protein (.1) AT5G66390 66 / 2e-14 Peroxidase superfamily protein (.1) AT2G18140 65 / 3e-14 Peroxidase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009935 [exp] 129 / 2e-38 AT5G05340 358 / 9e-124 Peroxidase superfamily protein (.1) Lus10009936 [exp] 99 / 9e-27 AT5G05340 361 / 5e-125 Peroxidase superfamily protein (.1) Lus10030145 [exp] 97 / 7e-26 AT5G05340 353 / 2e-121 Peroxidase superfamily protein (.1) Lus10008581 [exp] 94 / 4e-25 AT5G05340 367 / 6e-128 Peroxidase superfamily protein (.1) Lus10009091 [exp] 81 / 2e-21 AT5G05340 137 / 3e-40 Peroxidase superfamily protein (.1) Lus10000625 [exp] 81 / 3e-21 AT5G05340 172 / 5e-54 Peroxidase superfamily protein (.1) Lus10025255 [exp] 82 / 2e-20 AT5G05340 337 / 2e-115 Peroxidase superfamily protein (.1) Lus10006534 [exp] 81 / 9e-20 AT5G05340 399 / 3e-140 Peroxidase superfamily protein (.1) Lus10030148 [exp] 79 / 2e-19 AT5G05340 410 / 3e-145 Peroxidase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G156800 [exp] 89 / 4e-23 AT5G05340 345 / 7e-119 Peroxidase superfamily protein (.1) Potri.014G143200 [exp] 83 / 6e-21 AT5G05340 404 / 5e-142 Peroxidase superfamily protein (.1) Potri.016G132900 [exp] 77 / 1e-18 AT5G05340 350 / 6e-121 Peroxidase superfamily protein (.1) Potri.016G132700 [exp] 75 / 6e-18 AT5G05340 367 / 2e-127 Peroxidase superfamily protein (.1) Potri.013G083600 [exp] 75 / 8e-18 AT5G05340 483 / 2e-173 Peroxidase superfamily protein (.1) Potri.003G214500 [exp] 75 / 9e-18 AT5G19890 422 / 4e-149 Peroxidase superfamily protein (.1) Potri.006G107000 [exp] 74 / 1e-17 AT5G05340 349 / 2e-120 Peroxidase superfamily protein (.1) Potri.007G019300 [exp] 74 / 2e-17 AT5G66390 507 / 0.0 Peroxidase superfamily protein (.1) Potri.010G236850 [exp] 73 / 3e-17 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1) Potri.010G236910 [exp] 73 / 3e-17 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004218 pacid=23175390 polypeptide=Lus10004218 locus=Lus10004218.g ID=Lus10004218.BGIv1.0 annot-version=v1.0 ATGCAGTCGAGAGGGCTTCTGCATTCCGACCAGGAGCTGCTCGGGAAAGGTAATAGTGCGAGTTATATGCTGGTGAGGATGTACGGAAGTAATCCGAGGA GGTTCGCGGCGGATTTTGCAGCGTCGATGGTTAAGATGGGGAATATGAAGCCACTCACTGGGAATAATGGGGAGATTAGAAAGAATTGCCGCATCGTTAA TTAA
AA sequence Show only first row Show all	>Lus10004218 pacid=23175390 polypeptide=Lus10004218 locus=Lus10004218.g ID=Lus10004218.BGIv1.0 annot-version=v1.0 MQSRGLLHSDQELLGKGNSASYMLVRMYGSNPRRFAADFAASMVKMGNMKPLTGNNGEIRKNCRIVN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G14550			Peroxidase superfamily protein...		Lus10004218 [exp]	0	1
AT4G12340			copper ion binding (.1)		Lus10024588 [exp]	3.7	0.8535
AT5G58530			Glutaredoxin family protein (....		Lus10017438 [exp]	4.0	0.8228
AT4G22670		ATHIP1, TPR11	tetratricopeptide repeat 11, H...		Lus10032227 [exp]	7.3	0.8391
AT4G10750			Phosphoenolpyruvate carboxylas...		Lus10017323 [exp]	10.1	0.8179
AT2G17265		DMR1, HSK	DOWNY MILDEW RESISTANT 1, homo...		Lus10022990 [exp]	11.7	0.8289
AT1G08010	GATA	GATA11	GATA transcription factor 11 (...		Lus10016092 [exp]	13.0	0.8186
AT5G05950		MEE60	maternal effect embryo arrest ...		Lus10009873 [exp]	14.4	0.8173
AT5G65250			unknown protein		Lus10000635 [exp]	22.2	0.8006
AT1G15710			prephenate dehydrogenase famil...		Lus10023121 [exp]	22.8	0.8179
AT1G52530			unknown protein		Lus10003678 [exp]	26.4	0.7865

Compare expression of checked genes

Lus10004218 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.