Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06300 293 / 1e-102 LOG7 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) AT2G37210 262 / 2e-90 LOG3 LONELY GUY 3, lysine decarboxylase family protein (.1.2) AT3G53450 261 / 4e-90 LOG4 LONELY GUY 4, Putative lysine decarboxylase family protein (.1) AT2G28305 251 / 8e-86 ATLOG1 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) AT2G35990 242 / 4e-83 LOG2 LONELY GUY 2, Putative lysine decarboxylase family protein (.1.2.3) AT4G35190 230 / 1e-77 LOG5 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) AT5G11950 213 / 4e-71 LOG8 LONELY GUY 8, Putative lysine decarboxylase family protein (.1.2) AT5G03270 177 / 1e-56 LOG6 LONELY GUY 6, lysine decarboxylase family protein (.1) AT5G26140 154 / 1e-48 ATLOG9 LONELY GUY 9, Putative lysine decarboxylase family protein (.1) AT1G50575 45 / 5e-06 Putative lysine decarboxylase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029425 [exp] 308 / 3e-108 AT5G06300 303 / 2e-105 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10026513 [exp] 259 / 5e-89 AT2G37210 394 / 1e-141 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10016096 [exp] 256 / 1e-87 AT2G28305 384 / 7e-138 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Lus10021462 [exp] 254 / 4e-87 AT2G28305 386 / 1e-138 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Lus10012436 [exp] 254 / 9e-87 AT5G06300 332 / 7e-117 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10024328 [exp] 250 / 2e-85 AT5G06300 328 / 2e-115 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10002226 [exp] 248 / 7e-85 AT2G37210 379 / 2e-135 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10003335 [exp] 242 / 3e-82 AT4G35190 359 / 2e-127 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Lus10022638 [exp] 241 / 2e-81 AT4G35190 365 / 2e-129 LONELY GUY 5, Putative lysine decarboxylase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G204800 [exp] 282 / 2e-98 AT5G06300 316 / 9e-111 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Potri.016G072000 [exp] 282 / 2e-98 AT5G06300 323 / 1e-113 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Potri.016G090500 [exp] 259 / 4e-89 AT2G37210 392 / 8e-141 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.006G127400 [exp] 259 / 7e-89 AT2G37210 396 / 3e-142 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.005G237600 [exp] 256 / 6e-88 AT5G06300 338 / 2e-119 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Potri.002G024000 [exp] 253 / 8e-87 AT2G37210 310 / 2e-108 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.009G010800 [exp] 250 / 1e-85 AT2G28305 359 / 8e-128 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.004G212200 [exp] 249 / 2e-85 AT2G28305 361 / 1e-128 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.004G181800 [exp] 239 / 4e-81 AT4G35190 361 / 3e-128 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Potri.002G012500 [exp] 237 / 3e-80 AT4G35190 300 / 5e-104 LONELY GUY 5, Putative lysine decarboxylase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0349 [flax] [poplar] SLOG PF03641 [flax] [poplar] Lysine_decarbox Possible lysine decarboxylase
Representative CDS sequence Show only first row Show all	>Lus10004222 pacid=23175386 polypeptide=Lus10004222 locus=Lus10004222.g ID=Lus10004222.BGIv1.0 annot-version=v1.0 ATGGGTCTTGTTTCTCAGGCAGTTCATGATGGAGGGCGCCATGTTCTAGGGGTCATTCCAAGGACTCTAATGCCAATCGAGATAACTGGGGGGTCAGTTG GAGAAGTTAGAGCTGTATCAGATATGCACCAAAGGAAAGCTGAAATGGCACGCCAAGCCGACGCTTTCATCGCCTTGCCAGGAGGCTACGGAACCCTAGA GGAACTTTTGGAGGTCATTACTTGGGCTCAGCTTGGCATCCATCGCAAACCCGTGGGCTTGCTGAACGTGGATGGGTACTACAACTCATTGTTGAGTTTC ATAGACAAAGCCGTTGATGAAGGCTTCATCTCCCCGACAGCACGTCGCATAATTGTGTCTGCCCCGACAGCCAAGGAATTAGTCAGGCAACTTGAGGAAT ATGAACCAGAGTATGATGAAGTAACGGCCAAGTTGGTGTGGGAGGAGGTGGATAGAAGACCATACGTTGTCGAATCAGGGGTCGCCACGATATGA
AA sequence Show only first row Show all	>Lus10004222 pacid=23175386 polypeptide=Lus10004222 locus=Lus10004222.g ID=Lus10004222.BGIv1.0 annot-version=v1.0 MGLVSQAVHDGGRHVLGVIPRTLMPIEITGGSVGEVRAVSDMHQRKAEMARQADAFIALPGGYGTLEELLEVITWAQLGIHRKPVGLLNVDGYYNSLLSF IDKAVDEGFISPTARRIIVSAPTAKELVRQLEEYEPEYDEVTAKLVWEEVDRRPYVVESGVATI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G06300		LOG7	LONELY GUY 7, Putative lysine ...		Lus10004222 [exp]	0	1
AT5G41810			unknown protein		Lus10003901 [exp]	4.6	0.9731
AT3G22490			Seed maturation protein (.1)		Lus10022058 [exp]	4.9	0.9680
AT1G56140			Leucine-rich repeat transmembr...		Lus10031401 [exp]	6.3	0.9669
AT3G28050			nodulin MtN21 /EamA-like trans...		Lus10039478 [exp]	6.9	0.9683
					Lus10000100 [exp]	7.3	0.9619
AT1G11530		ATCXXS1	C-terminal cysteine residue is...		Lus10007630 [exp]	7.4	0.9668
AT2G46680	HD	ATHB7, ATHB-7	ARABIDOPSIS THALIANA HOMEOBOX ...		Lus10008840 [exp]	8.5	0.9665
AT3G49180		RID3	ROOT INITIATION DEFECTIVE 3, T...		Lus10016759 [exp]	9.7	0.9520
AT4G21790		ATTOM1, TOM1	tobamovirus multiplication 1 (...		Lus10018348 [exp]	10.2	0.9644
AT1G70840		MLP31	MLP-like protein 31 (.1)		Lus10020497 [exp]	10.6	0.9626

Compare expression of checked genes

Lus10004222 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.