Lus10004223 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G73260 78 / 1e-17 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
AT1G17860 71 / 4e-15 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73325 63 / 3e-12 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73330 50 / 1e-07 ATDR4 drought-repressed 4 (.1)
AT3G04320 40 / 0.0003 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029429 388 / 2e-139 AT1G73260 77 / 4e-17 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Lus10039209 88 / 2e-21 AT1G17860 179 / 6e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039208 86 / 1e-20 AT1G17860 172 / 2e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039210 84 / 8e-20 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039163 84 / 9e-20 AT1G17860 167 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013732 83 / 1e-19 AT1G17860 166 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007889 83 / 2e-19 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013770 82 / 7e-19 AT1G17860 166 / 6e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10011090 81 / 9e-19 AT1G17860 161 / 4e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G000400 207 / 4e-68 AT1G73260 91 / 9e-23 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.001G309900 185 / 2e-59 AT1G17860 90 / 2e-22 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.007G111600 185 / 2e-59 AT1G73260 70 / 8e-15 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.019G006900 177 / 2e-56 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.007G111500 177 / 3e-56 AT1G73260 79 / 5e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.007G111800 168 / 1e-52 AT1G73260 79 / 3e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.007G111700 165 / 9e-52 AT1G73260 70 / 1e-14 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.004G067900 91 / 1e-22 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153200 88 / 2e-21 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153400 83 / 1e-19 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Lus10004223 pacid=23175396 polypeptide=Lus10004223 locus=Lus10004223.g ID=Lus10004223.BGIv1.0 annot-version=v1.0
ATGGCTTCTTCAACTACAATCATTCTCCACACCATGATGATCTGGCTAATCATAGCCATATCCGTCACGGCGCAATCCACCTCCCCATCGATCCTTGACA
CAGCCGGGCAGCCGGTGAGGCGCGGGGTGAACTACTACATCCTCCCTGCAATAACCGACGTTGCGGGAGGGCTAACCCTGATGCCCCGCAACGCCACGAG
CAACTGCCCCCTCTACGTGGGACAGGTGCCCCTTGCCCAGGTCGTGTCCCAGGGGCTCCCTGCAACTTTCGCCCCGTTCGCCAACGGAGAGAACATTGTG
AGGGAGTCAAGGGACCTGACCGTTACGTTCTCGGCCGCCACAACATGCCAACAGGGGACGTCGTGGGTGATTGGAGAAGAGGATGCTCAGAGTCGGAGGA
GGCTTCTCAGGGCCGGTGGTGGGACGACACCGAGTTACTTCAGGATTGATAGGAACACGACGACTAATGCGTATCAGTTCGTGTGGTGTCCTGGGGAGTC
GTGCACTGCCCCGAACTGCGGGAGGCCGAGGTGCGGAGCTGCTGGGATCTTGGTTCGCGGTCGGACTAGGTTCTTGGCACTGGATGGCCCTGCTTTCCCT
TTTCGATTCATGAGGGCTTAG
AA sequence
>Lus10004223 pacid=23175396 polypeptide=Lus10004223 locus=Lus10004223.g ID=Lus10004223.BGIv1.0 annot-version=v1.0
MASSTTIILHTMMIWLIIAISVTAQSTSPSILDTAGQPVRRGVNYYILPAITDVAGGLTLMPRNATSNCPLYVGQVPLAQVVSQGLPATFAPFANGENIV
RESRDLTVTFSAATTCQQGTSWVIGEEDAQSRRRLLRAGGGTTPSYFRIDRNTTTNAYQFVWCPGESCTAPNCGRPRCGAAGILVRGRTRFLALDGPAFP
FRFMRA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G73260 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TR... Lus10004223 0 1
AT4G19810 ChiC class V chitinase, Glycosyl hy... Lus10019060 1.4 0.9890
AT4G36220 CYP84A1, FAH1, ... ferulic acid 5-hydroxylase 1 (... Lus10041511 2.0 0.9861
AT4G01575 serine protease inhibitor, Kaz... Lus10030164 2.6 0.9811
AT4G36220 CYP84A1, FAH1, ... ferulic acid 5-hydroxylase 1 (... Lus10012583 3.5 0.9847
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10006552 8.1 0.9760
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Lus10022762 10.8 0.9855
AT5G05600 2-oxoglutarate (2OG) and Fe(II... Lus10004808 11.4 0.9784
Lus10003173 12.0 0.9790
AT1G35210 unknown protein Lus10010343 13.8 0.9847
AT5G39160 RmlC-like cupins superfamily p... Lus10032016 14.1 0.9844

Lus10004223 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.