Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06210 96 / 1e-26 RNA binding (RRM/RBD/RNP motifs) family protein (.1) AT3G23830 61 / 3e-13 AtGRP4, GR-RBP4, GRP4 glycine-rich RNA-binding protein 4 (.1.2) AT2G37510 61 / 3e-13 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G20030 61 / 5e-13 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G54580 61 / 6e-13 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G13860 56 / 7e-12 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G59860 57 / 1e-11 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G46020 56 / 2e-11 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G39260 55 / 4e-11 ATGRP8, CCR1, GR-RBP8 glycine-rich RNA-binding protein 8, GLYCINE-RICH PROTEIN 8, cold, circadian rhythm, and RNA binding 1 (.1.2.3.4) AT4G13850 54 / 1e-10 ATGRP2, GR-RBP2 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029426 [exp] 149 / 5e-44 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10003980 [exp] 62 / 2e-13 AT2G37510 169 / 1e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10023758 [exp] 61 / 5e-13 AT2G37510 164 / 9e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10013306 [exp] 61 / 6e-13 AT5G06210 94 / 3e-25 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Lus10003593 [exp] 59 / 3e-11 AT5G54580 174 / 6e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10014802 [exp] 58 / 3e-11 AT5G54580 176 / 2e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10032591 [exp] 55 / 1e-10 AT4G13850 157 / 5e-50 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10005891 [exp] 56 / 2e-10 AT3G45980 230 / 1e-76 HISTONE H2B, Histone superfamily protein (.1) Lus10043158 [exp] 53 / 5e-10 AT4G13850 154 / 1e-48 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G208500 [exp] 102 / 2e-29 AT5G06210 160 / 1e-51 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.011G130300 [exp] 59 / 5e-12 AT5G54580 161 / 2e-51 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G409800 [exp] 58 / 9e-12 AT5G54580 174 / 2e-56 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.016G090700 [exp] 57 / 4e-11 AT2G37220 302 / 4e-103 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.012G038200 [exp] 56 / 8e-11 AT1G73530 141 / 6e-43 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.003G074900 [exp] 55 / 9e-11 AT4G20030 164 / 2e-52 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.009G160300 [exp] 53 / 2e-10 AT2G27330 98 / 1e-27 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.015G057400 [exp] 54 / 5e-10 AT5G61030 157 / 8e-47 glycine-rich RNA-binding protein 3 (.1) Potri.008G022280 [exp] 53 / 6e-10 AT3G20930 203 / 2e-65 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.010G237200 [exp] 54 / 1e-09 AT3G20930 429 / 5e-150 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [flax] [poplar] RRM PF00076 [flax] [poplar] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Lus10004224 pacid=23175393 polypeptide=Lus10004224 locus=Lus10004224.g ID=Lus10004224.BGIv1.0 annot-version=v1.0 ATGGACTCGGTATCATCAAGGATGCTGATTTTTTGTTCTGATGCAACCAAGGTTATAACGGACAGAGTCTCCAACAAATCAAAGGGGTTTGGTTTCGTAA CTTTTGCTTCTGCTGATGAAGCCGAGAAAGCCATAACTGAGATGGACGGGAAGAGTCTGAATGGTCGAGTCATTTTTGTCGATATCGCGAGAGCTAAATC TAGCTTTGGAGACGGAATTCCAATCGCTAGAGGACCTCCGGAAGGGCTTCAAATCAACAACACCCCATTGCTGACTTCTGAAACAGTTACAATGTAG
AA sequence Show only first row Show all	>Lus10004224 pacid=23175393 polypeptide=Lus10004224 locus=Lus10004224.g ID=Lus10004224.BGIv1.0 annot-version=v1.0 MDSVSSRMLIFCSDATKVITDRVSNKSKGFGFVTFASADEAEKAITEMDGKSLNGRVIFVDIARAKSSFGDGIPIARGPPEGLQINNTPLLTSETVTM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G06210			RNA binding (RRM/RBD/RNP motif...		Lus10004224 [exp]	0	1
AT1G62510			Bifunctional inhibitor/lipid-t...		Lus10001493 [exp]	4.5	0.7967
AT5G52850			Pentatricopeptide repeat (PPR)...		Lus10038834 [exp]	6.3	0.7223
					Lus10024012 [exp]	8.1	0.7318
					Lus10015336 [exp]	9.7	0.7356
AT3G46570			Glycosyl hydrolase superfamily...		Lus10000070 [exp]	12.6	0.7256
					Lus10019512 [exp]	16.7	0.7139
AT4G26830			O-Glycosyl hydrolases family 1...		Lus10011852 [exp]	17.3	0.6577
AT1G11410			S-locus lectin protein kinase ...		Lus10007610 [exp]	27.5	0.6874
AT5G17850			Sodium/calcium exchanger famil...		Lus10034284 [exp]	28.1	0.6917
AT3G02210		COBL1	COBRA-like protein 1 precursor...		Lus10033047 [exp]	28.5	0.6712

Compare expression of checked genes

Lus10004224 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.