Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62575 80 / 3e-21 SDH7B, SDH7 succinate dehydrogenase 7B, succinate dehydrogenase 7, unknown protein AT3G47833 72 / 3e-18 SDH7A, SDH7 succinate dehydrogenase 7A, succinate dehydrogenase 7, unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042141 [exp] 115 / 1e-34 AT5G62575 111 / 2e-32 succinate dehydrogenase 7B, succinate dehydrogenase 7, unknown protein Lus10034122 [exp] 56 / 1e-11 AT5G62575 83 / 1e-21 succinate dehydrogenase 7B, succinate dehydrogenase 7, unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G077101 [exp] 86 / 1e-23 AT5G62575 131 / 2e-41 succinate dehydrogenase 7B, succinate dehydrogenase 7, unknown protein Potri.015G072100 [exp] 83 / 2e-22 AT5G62575 131 / 4e-41 succinate dehydrogenase 7B, succinate dehydrogenase 7, unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004231 pacid=23177811 polypeptide=Lus10004231 locus=Lus10004231.g ID=Lus10004231.BGIv1.0 annot-version=v1.0 ATGTCGAGATGGGGCAGCGAGAGAAAGCCCCATAATCACGATGAGACTATCATAATGCAGCTTCTGGCAGAGAATCCGGCTATCAATAGATTCAAATCCT ACAGGAAGGGTGTGTCCAAAATTAACAAAATTGGAGATTTGCTCACAGTTGTTGTCGTAGCAGGTTGCTGCTATGAGATCTACGTGAAAGCAACAATGCG GGAAGAAGCACGCAGACAGACTGGTGCGAGTGCTTAA
AA sequence Show only first row Show all	>Lus10004231 pacid=23177811 polypeptide=Lus10004231 locus=Lus10004231.g ID=Lus10004231.BGIv1.0 annot-version=v1.0 MSRWGSERKPHNHDETIIMQLLAENPAINRFKSYRKGVSKINKIGDLLTVVVVAGCCYEIYVKATMREEARRQTGASA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G62575		SDH7B, SDH7	succinate dehydrogenase 7B, su...		Lus10004231 [exp]	0	1
AT2G29640		JOSL	JOSEPHIN-like protein (.1)		Lus10018214 [exp]	34.7	0.6221
AT2G46580			Pyridoxamine 5'-phosphate oxid...		Lus10030234 [exp]	47.2	0.6332
AT4G32300		SD2-5	S-domain-2 5 (.1)		Lus10034193 [exp]	62.5	0.6201
AT1G16040			unknown protein		Lus10032921 [exp]	64.4	0.6001
AT1G03430		AHP5	histidine-containing phosphotr...		Lus10029623 [exp]	69.6	0.5814
					Lus10010387 [exp]	78.1	0.5662
AT3G52730			ubiquinol-cytochrome C reducta...		Lus10017043 [exp]	85.5	0.6087
AT2G30860		GLUTTR, ATGSTF7...	glutathione S-transferase PHI ...		Lus10029815 [exp]	116.2	0.5423
AT1G20510		OPCL1	OPC-8:0 CoA ligase1 (.1.2)		Lus10007063 [exp]	122.5	0.5532
					Lus10015042 [exp]	125.0	0.5288

Compare expression of checked genes

Lus10004231 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.