Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22110 347 / 3e-123 PAC1 20S proteasome alpha subunit C1 (.1) AT4G15165 238 / 2e-80 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) AT3G14290 155 / 2e-47 PAE2 20S proteasome alpha subunit E2 (.1) AT1G53850 155 / 2e-47 PAE1, ATPAE1 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) AT3G51260 153 / 1e-46 PAD1 20S proteasome alpha subunit PAD1 (.1.2) AT5G66140 152 / 2e-46 PAD2 proteasome alpha subunit D2 (.1) AT1G16470 136 / 2e-40 PAB1 proteasome subunit PAB1 (.1.2) AT1G79210 136 / 3e-40 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT5G35590 129 / 3e-37 PAA1 proteasome alpha subunit A1 (.1) AT5G42790 125 / 1e-35 ARS5, ATPSM30, PAF1 ARSENIC TOLERANCE 5, proteasome alpha subunit F1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042145 [exp] 364 / 1e-129 AT3G22110 474 / 3e-172 20S proteasome alpha subunit C1 (.1) Lus10028437 [exp] 148 / 1e-44 AT5G66140 417 / 8e-150 proteasome alpha subunit D2 (.1) Lus10041890 [exp] 148 / 1e-44 AT5G66140 442 / 9e-160 proteasome alpha subunit D2 (.1) Lus10037454 [exp] 152 / 3e-43 AT1G53850 464 / 8e-163 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10003936 [exp] 152 / 5e-43 AT1G53850 463 / 9e-162 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10036210 [exp] 130 / 8e-38 AT1G16470 450 / 3e-163 proteasome subunit PAB1 (.1.2) Lus10017135 [exp] 129 / 1e-37 AT1G16470 454 / 1e-164 proteasome subunit PAB1 (.1.2) Lus10024269 [exp] 129 / 4e-37 AT5G42790 440 / 4e-158 ARSENIC TOLERANCE 5, proteasome alpha subunit F1 (.1) Lus10007396 [exp] 129 / 4e-37 AT5G42790 442 / 8e-159 ARSENIC TOLERANCE 5, proteasome alpha subunit F1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G008800 [exp] 353 / 1e-125 AT3G22110 452 / 1e-163 20S proteasome alpha subunit C1 (.1) Potri.016G015400 [exp] 350 / 5e-124 AT3G22110 445 / 1e-160 20S proteasome alpha subunit C1 (.1) Potri.004G174200 [exp] 156 / 7e-48 AT3G51260 406 / 2e-145 20S proteasome alpha subunit PAD1 (.1.2) Potri.009G133800 [exp] 156 / 1e-47 AT5G66140 409 / 2e-146 proteasome alpha subunit D2 (.1) Potri.001G162900 [exp] 153 / 1e-46 AT3G14290 471 / 4e-171 20S proteasome alpha subunit E2 (.1) Potri.003G072500 [exp] 146 / 4e-44 AT3G14290 464 / 1e-168 20S proteasome alpha subunit E2 (.1) Potri.012G123550 [exp] 138 / 8e-41 AT1G16470 456 / 1e-165 proteasome subunit PAB1 (.1.2) Potri.015G122400 [exp] 138 / 8e-41 AT1G16470 456 / 1e-165 proteasome subunit PAB1 (.1.2) Potri.005G229200 [exp] 128 / 2e-36 AT5G42790 455 / 9e-164 ARSENIC TOLERANCE 5, proteasome alpha subunit F1 (.1) Potri.002G033900 [exp] 127 / 2e-36 AT5G42790 449 / 1e-161 ARSENIC TOLERANCE 5, proteasome alpha subunit F1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [flax] [poplar] NTN PF00227 [flax] [poplar] Proteasome Proteasome subunit CL0052 [flax] [poplar] NTN PF10584 [flax] [poplar] Proteasome_A_N Proteasome subunit A N-terminal signature
Representative CDS sequence Show only first row Show all	>Lus10004235 pacid=23177792 polypeptide=Lus10004235 locus=Lus10004235.g ID=Lus10004235.BGIv1.0 annot-version=v1.0 ATGTCTAGGAGGTACGATAGCCGCACGACGATCTTCTCCCCAGAGGGTCGTCTCTACCAAGTTGAGTATGCAATGGAGGCTATTGGCAATGCCGGAAGTG CTATCGGCATATTGGCAAAAGACGGAGTTGTCTTGGTCGGTGAAAAGAAGGTTACTTCCAAGCTTCTCCAGACATCAACCTCTACCGAGAAGATGTACAA GATCGACGACCATGTCGCCTGTGCCGTTGCTGGAATCATGTCGGATGCAAACATCTTGATCAACACGGCGAGACTCCAGGCGCAACGCTACACCTTTGCG TACCAGGAGCCGATGCCCGTGGAGCAGCTGGTTCAATCTCTGTGCGATACCAAGCAAGGGTACACCCAATTCGGAGGCCTCAGGCCTTTTGGAGTCTCGT TTCTTTTTGCAGGGTGGGACAAGAACTACGGGTTCCAGCTTTACACGAGCGACCCTAGTGGGAACTATGGTGGCTGGAAGGCAGCAGCTGTAGGTGCAAA CAACCAAGCAGCTCAGTCCATGCTTAAACAGGACTACAAGGATGATATCTCCAGAGAATAG
AA sequence Show only first row Show all	>Lus10004235 pacid=23177792 polypeptide=Lus10004235 locus=Lus10004235.g ID=Lus10004235.BGIv1.0 annot-version=v1.0 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILAKDGVVLVGEKKVTSKLLQTSTSTEKMYKIDDHVACAVAGIMSDANILINTARLQAQRYTFA YQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNYGFQLYTSDPSGNYGGWKAAAVGANNQAAQSMLKQDYKDDISRE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22110		PAC1	20S proteasome alpha subunit C...		Lus10004235 [exp]	0	1
AT4G24820			26S proteasome, regulatory sub...		Lus10014916 [exp]	1.0	0.9453
AT1G56450		PBG1	20S proteasome beta subunit G1...		Lus10036124 [exp]	1.4	0.9399
AT3G26340			N-terminal nucleophile aminohy...		Lus10006426 [exp]	3.5	0.9390
AT4G18040		LSP1, CUM1, AT....	eukaryotic translation Initiat...		Lus10005410 [exp]	4.0	0.9176
AT1G64520		RPN12A	regulatory particle non-ATPase...		Lus10032420 [exp]	4.5	0.9304
AT3G26340			N-terminal nucleophile aminohy...		Lus10011369 [exp]	10.7	0.9304
AT5G18800			Cox19-like CHCH family protein...		Lus10033991 [exp]	12.2	0.9067
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10031085 [exp]	13.0	0.8953
AT5G57290			60S acidic ribosomal protein f...		Lus10012714 [exp]	13.2	0.9206
AT1G60170		EMB1220	embryo defective 1220, pre-mRN...		Lus10012997 [exp]	13.8	0.9112

Compare expression of checked genes

Lus10004235 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.