Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22110 79 / 3e-20 PAC1 20S proteasome alpha subunit C1 (.1) AT4G15165 77 / 1e-19 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042145 [exp] 102 / 6e-29 AT3G22110 474 / 3e-172 20S proteasome alpha subunit C1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G008800 [exp] 93 / 2e-25 AT3G22110 452 / 1e-163 20S proteasome alpha subunit C1 (.1) Potri.016G015400 [exp] 91 / 1e-24 AT3G22110 445 / 1e-160 20S proteasome alpha subunit C1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004236 pacid=23177813 polypeptide=Lus10004236 locus=Lus10004236.g ID=Lus10004236.BGIv1.0 annot-version=v1.0 ATGGATAGCACGACCTTGACTTCTGATAAGCTTGAGCTGGCTGAGGTGTTCCTGTCTCCTTCGGGGACTGTCAAGTACCAAGTTTGCACCCCTGATTCTC TTAGCAAGCTGTTGGTGAAATTTGGAGTGACTCAACCTGCTGCTGAGGCTTAG
AA sequence Show only first row Show all	>Lus10004236 pacid=23177813 polypeptide=Lus10004236 locus=Lus10004236.g ID=Lus10004236.BGIv1.0 annot-version=v1.0 MDSTTLTSDKLELAEVFLSPSGTVKYQVCTPDSLSKLLVKFGVTQPAAEA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22110		PAC1	20S proteasome alpha subunit C...		Lus10004236 [exp]	0	1
AT4G31460			Ribosomal L28 family (.1)		Lus10028995 [exp]	4.1	0.8709
AT2G42210		ATOEP16-3	Mitochondrial import inner mem...		Lus10016278 [exp]	4.9	0.8958
AT5G53650			unknown protein		Lus10008848 [exp]	5.9	0.8897
AT1G08830		CSD1	copper/zinc superoxide dismuta...		Lus10004139 [exp]	6.7	0.9071
AT3G58030			RING/U-box superfamily protein...		Lus10021063 [exp]	7.5	0.8768
AT1G26690			emp24/gp25L/p24 family/GOLD fa...		Lus10036786 [exp]	9.6	0.8658
AT5G52840			NADH-ubiquinone oxidoreductase...		Lus10039296 [exp]	12.3	0.8858
AT3G22110		PAC1	20S proteasome alpha subunit C...		Lus10004235 [exp]	14.3	0.8890
AT3G26340			N-terminal nucleophile aminohy...		Lus10006426 [exp]	16.4	0.8936
AT4G00860		AT0ZI1, ATOZI1	Arabidopsis thaliana ozone-ind...		Lus10007542 [exp]	17.0	0.8907

Compare expression of checked genes

Lus10004236 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.