Lus10004241 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G48140 132 / 6e-42 B12D protein (.1)
AT3G29970 101 / 1e-29 B12D protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042151 183 / 4e-62 AT3G48140 132 / 4e-42 B12D protein (.1)
Lus10015825 132 / 8e-42 AT3G48140 150 / 3e-49 B12D protein (.1)
Lus10036977 120 / 6e-37 AT3G48140 132 / 9e-42 B12D protein (.1)
Lus10035132 99 / 7e-29 AT3G29970 112 / 5e-34 B12D protein (.1)
Lus10031971 49 / 4e-08 AT5G60335 152 / 5e-47 Thioesterase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G074900 158 / 3e-52 AT3G48140 137 / 8e-44 B12D protein (.1)
Potri.008G179401 147 / 8e-48 AT3G48140 137 / 8e-44 B12D protein (.1)
Potri.010G055300 142 / 3e-45 AT3G48140 132 / 8e-41 B12D protein (.1)
Potri.017G098800 108 / 1e-32 AT3G29970 131 / 9e-42 B12D protein (.1)
Potri.004G117300 103 / 1e-30 AT3G29970 126 / 9e-40 B12D protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06522 B12D NADH-ubiquinone reductase complex 1 MLRQ subunit
Representative CDS sequence
>Lus10004241 pacid=23177821 polypeptide=Lus10004241 locus=Lus10004241.g ID=Lus10004241.BGIv1.0 annot-version=v1.0
ATGGCCGGAAATCGGTGGTTGAGGCCTGAGGTGTATCCTCTTTTCGCCGCTGTGGGAGCTGCTGTGGGGATCTGCGGGTTTCAACTTGTTCGCAACATCT
GCATCAACCCTGAAGTCAGGGTGAAGAAGGACAACAGGACTGCAGGAATTCTGGACAACTTCGCTGAAGGAGAGAAATACTCGGAGCATTACATCAGGAA
GCTAGTACGGAACAGGTCACCTGAGATCATGCCTTCCCTCAACGGCTTCTTCTCCAACCCCAAGTGA
AA sequence
>Lus10004241 pacid=23177821 polypeptide=Lus10004241 locus=Lus10004241.g ID=Lus10004241.BGIv1.0 annot-version=v1.0
MAGNRWLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVKKDNRTAGILDNFAEGEKYSEHYIRKLVRNRSPEIMPSLNGFFSNPK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G48140 B12D protein (.1) Lus10004241 0 1
AT3G48140 B12D protein (.1) Lus10042151 1.0 0.9692
AT5G09260 VPS20.2 vacuolar protein sorting-assoc... Lus10015693 3.5 0.9297
AT3G22845 emp24/gp25L/p24 family/GOLD fa... Lus10039381 4.6 0.9297
AT3G18620 DHHC-type zinc finger family p... Lus10013426 5.7 0.9365
AT5G20090 Uncharacterised protein family... Lus10025851 6.3 0.9211
AT2G38450 unknown protein Lus10001262 6.5 0.9215
AT1G73177 APC13, BNS anaphase-promoting complex 13,... Lus10007286 8.4 0.9082
AT3G46060 ARA3, Ara-3, At... RAB GTPase homolog 8A (.1.2.3) Lus10023430 9.6 0.9031
AT5G27720 LSM4, EMB1644 SM-like protein 4, embryo defe... Lus10029426 11.0 0.9081
AT2G26430 ATRCY1, RCY1 arginine-rich cyclin 1 (.1.2.3... Lus10041418 11.5 0.9280

Lus10004241 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.