Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19010 228 / 4e-73 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G19000 208 / 2e-65 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT4G25420 118 / 1e-30 AT2301, GA5, ATGA20OX1 GA REQUIRING 5, ARABIDOPSIS THALIANA GIBBERELLIN 20-OXIDASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10500 113 / 4e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G05600 112 / 1e-28 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G51810 109 / 1e-27 AT2353, GA20OX2, ATGA20OX2 gibberellin 20 oxidase 2 (.1) AT1G78550 108 / 3e-27 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 108 / 3e-27 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G24530 106 / 2e-26 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17020 105 / 4e-26 ATSRG1, SRG1 senescence-related gene 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023851 [exp] 238 / 4e-77 AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10020999 [exp] 230 / 6e-74 AT3G19000 473 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10021002 [exp] 209 / 6e-66 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10042155 [exp] 169 / 6e-52 AT3G19000 219 / 1e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10023850 [exp] 162 / 3e-49 AT3G19000 225 / 4e-73 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10006518 [exp] 122 / 4e-32 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10015252 [exp] 119 / 3e-31 AT1G17020 375 / 1e-129 senescence-related gene 1 (.1) Lus10015016 [exp] 116 / 4e-30 AT4G25420 494 / 3e-176 GA REQUIRING 5, ARABIDOPSIS THALIANA GIBBERELLIN 20-OXIDASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10011979 [exp] 115 / 6e-30 AT1G17020 374 / 4e-129 senescence-related gene 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G107600 [exp] 233 / 4e-75 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107550 [exp] 226 / 9e-73 AT3G19000 452 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146000 [exp] 207 / 5e-65 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146100 [exp] 207 / 9e-65 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.001G451900 [exp] 117 / 1e-30 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.015G134600 [exp] 117 / 2e-30 AT5G51810 525 / 0.0 gibberellin 20 oxidase 2 (.1) Potri.011G150100 [exp] 115 / 6e-30 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.008G069300 [exp] 115 / 8e-30 AT5G05600 528 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G101200 [exp] 115 / 9e-30 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G355100 [exp] 114 / 2e-29 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10004245 pacid=23177808 polypeptide=Lus10004245 locus=Lus10004245.g ID=Lus10004245.BGIv1.0 annot-version=v1.0 ATGGCCCCACAAGAGTTACAAGTTCCGGTCATCGACCTGGCCGGAGACATCGGGGTGGTGGTGGAGCAAGTGAAGAATGCTTGTAAAGAGTGGGGATTTT TCCAAGTGATCAACCATGGAGTGCCTCAGCATTTGGTACAGAGGATCCATGAGAGTTCCAAGGAGTTATTTGGTATGGCGTCGGAGGAGAAGAAGAAGGT GAAGAGGGACGAAGTGAATCCTTTGGGGGTTGTGTGCGAGGAATATGCAGGAGAAATAGAGAAACTAGCCTTGAAGCTCATAGAAATAATATCCCTGAGC TTAGGATTGCCTGCTGATAGGCTAAACAGATACTTTGAGAATCAGATCAGCTTTGTTAGGATCAATCACTACCCACCTTGCCCATTTCCTGACTCGACTT CTCTGGGCTGTGGTCGATACAAAGATCCTGAAGCGCTCACTATCCTGGCCTATGATGGTGTTGGAGGGCTAGAGGTTAAGAGCAACTTCGACGGTCACTG GGTTCCGATCAAACCCCTTCTCGACGCATTCATCATCAACGTTGGCGAGATTTGTCAGGTTTGGAGCAATGATAAGTACACGAACGTAGAGCACATAATA GTCGTTAATGAGGAGAACGAGAGGTATTCATTTGCGTGGTTTTTGGCACCGTCTCACGATGTAATGGTGAAGCCGCTGGAGGAGTTAGTGAGTGAGGAAG ATCCCGCCAAATATTTTCCTTATAATTGGGGGAAATGTTATGCGAGTAGAAACCGCAGCGATTATAAAAAGCGTAATATTGAAAACATTCAAATCGATGA TTTGATTGTTCCCTATTTGATTAATTGA
AA sequence Show only first row Show all	>Lus10004245 pacid=23177808 polypeptide=Lus10004245 locus=Lus10004245.g ID=Lus10004245.BGIv1.0 annot-version=v1.0 MAPQELQVPVIDLAGDIGVVVEQVKNACKEWGFFQVINHGVPQHLVQRIHESSKELFGMASEEKKKVKRDEVNPLGVVCEEYAGEIEKLALKLIEIISLS LGLPADRLNRYFENQISFVRINHYPPCPFPDSTSLGCGRYKDPEALTILAYDGVGGLEVKSNFDGHWVPIKPLLDAFIINVGEICQVWSNDKYTNVEHII VVNEENERYSFAWFLAPSHDVMVKPLEELVSEEDPAKYFPYNWGKCYASRNRSDYKKRNIENIQIDDLIVPYLIN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G19010			2-oxoglutarate (2OG) and Fe(II...		Lus10004245 [exp]	0	1
AT2G16460			Protein of unknown function (D...		Lus10041812 [exp]	2.4	0.9736
AT5G13825			unknown protein		Lus10000042 [exp]	4.7	0.9575
AT1G65480		FT	FLOWERING LOCUS T, PEBP (phosp...		Lus10013532 [exp]	6.9	0.9241
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10002774 [exp]	8.1	0.9516
AT1G68310		AE7	AS1/2 ENHANCER7, Protein of un...		Lus10031007 [exp]	9.2	0.9475
AT4G31920	GARP	ARR10	response regulator 10 (.1)		Lus10025044 [exp]	10.6	0.9393
					Lus10014195 [exp]	12.7	0.9368
					Lus10020194 [exp]	14.8	0.9333
					Lus10002411 [exp]	14.8	0.9572
AT4G23310		CRK23	cysteine-rich RLK (RECEPTOR-li...		Lus10009583 [exp]	17.1	0.9207

Compare expression of checked genes

Lus10004245 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.