Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042157 [exp] 99 / 1e-29 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G074300 [exp] 82 / 7e-23 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004247 pacid=23177816 polypeptide=Lus10004247 locus=Lus10004247.g ID=Lus10004247.BGIv1.0 annot-version=v1.0 ATGGGAATAGGAAGCAAAGCTGCCGACTGGACATTCAAGGGATTCACGGCGGCTCTCGGCGTCACCACCATCTACCTTACCGCCACTTTCTCCGTCAACG TCTACCGCGGCCTCTCCTGGCACAAGGCCCAATCGGTAACCCTAAACCCCCCTTCGGATTGA
AA sequence Show only first row Show all	>Lus10004247 pacid=23177816 polypeptide=Lus10004247 locus=Lus10004247.g ID=Lus10004247.BGIv1.0 annot-version=v1.0 MGIGSKAADWTFKGFTAALGVTTIYLTATFSVNVYRGLSWHKAQSVTLNPPSD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10004247 [exp]	0	1
					Lus10042157 [exp]	1.0	0.8584
AT1G02816			Protein of unknown function, D...		Lus10009855 [exp]	13.5	0.7206
AT1G04880	ARID		HMG (high mobility group) box ...		Lus10016671 [exp]	17.1	0.7970
AT1G22950			2-oxoglutarate (2OG) and Fe(II...		Lus10000171 [exp]	19.9	0.7245
AT3G48425			DNAse I-like superfamily prote...		Lus10043333 [exp]	28.2	0.7323
AT1G53520			Chalcone-flavanone isomerase f...		Lus10026174 [exp]	35.8	0.7579
					Lus10026444 [exp]	39.2	0.6896
AT1G32730			unknown protein		Lus10001085 [exp]	42.4	0.7289
					Lus10034993 [exp]	42.9	0.7462
AT2G45850	AT-hook		AT hook motif DNA-binding fami...		Lus10037858 [exp]	48.8	0.7441

Compare expression of checked genes

Lus10004247 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.