Lus10004268 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62740 494 / 6e-179 AtHIR4, ATHIR1 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT1G69840 464 / 5e-167 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
AT3G01290 438 / 1e-156 AtHIR2 hypersensitive induced reaction 2, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT5G51570 322 / 7e-111 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT5G54100 55 / 2e-08 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT4G27585 49 / 2e-06 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033099 516 / 0 AT5G62740 533 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10007268 487 / 6e-176 AT5G62740 510 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015356 483 / 2e-174 AT5G62740 506 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10036715 461 / 5e-166 AT1G69840 516 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
Lus10037213 461 / 5e-166 AT1G69840 514 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
Lus10038907 309 / 8e-106 AT5G51570 529 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015032 306 / 2e-104 AT5G51570 532 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10032909 55 / 2e-08 AT4G27585 498 / 4e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G070500 491 / 8e-178 AT5G62740 484 / 3e-175 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.017G078100 485 / 2e-175 AT5G62740 488 / 3e-176 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.017G078000 473 / 1e-170 AT5G62740 518 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G130600 318 / 1e-109 AT5G51570 510 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G129000 312 / 4e-107 AT5G51570 480 / 4e-173 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G065001 294 / 7e-101 AT5G62740 312 / 4e-108 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G005500 54 / 3e-08 AT4G27585 463 / 3e-162 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G001900 51 / 3e-07 AT4G27585 499 / 2e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G009800 51 / 4e-07 AT4G27585 382 / 3e-130 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0433 SPFH PF01145 Band_7 SPFH domain / Band 7 family
Representative CDS sequence
>Lus10004268 pacid=23177790 polypeptide=Lus10004268 locus=Lus10004268.g ID=Lus10004268.BGIv1.0 annot-version=v1.0
ATGGGTAATCTGTTGTGCTGCGTGCAAGTTGATCAGTCCACTGTAGCTATAAAGGAAAGATTCGGGAAGTTTGAGGAAGTTCTCGAGCCAGGATGCCATT
GTCTTCCGTGGTTTCTTGGGAGCCAGGTATCTGGCAATCTGTCTCTGAGAGTTCAACAGCTGGATGTTCGCTGTGAGACTAAGACAAAGGACAATGTTTT
TGTTACCGTTGTTGCTTCAATTCAATACCGTGCCCTGGCAGAGAGGGCAAATGATGCTTACTACAAGCTCAGCAACACCAGGGGCCAAATCCAGGCCTAT
GTCTTTGATGTGATTAGAGCAAGTGTCCCAAAGCTCAGTCTGGATGATACTTTTGAACAGAAGAATGACATTGCCAAAGCTGTTGAAGATGAACTCGAAA
AGGCCATGTCTCACTATGGATACGAGATTGTGCAAACACTTATCGTCGACATTGAACCAGACGAGCATGTAAAGAGGGCCATGAATGAAATCAATGCTGC
TGCAAGGATGAGGATGGCAGCCAACGACAAGGCAGAGGCTGAAAAGATTTTGCAGATCAAGAGAGCTGAAGGTGAGGCTGAATCCAAGTACCTCTCCGGG
TTGGGTATTGCTCGCCAGAGGCAAGCAATTGTGGATGGCTTAAGAGACAGCGTTCTTGGATTCTCTGAGAATGTCCCTGGAACATCTGCAAGAGACGTCA
TGGACATGGTTCTCGTGACACAATATTTTGACACGATGAAGGAAATCGGCGCTACCTCCAAATCCTCAGCGGTGTTCATCCCCCACGGTCCTGGTGCTGT
TCGCGACGTTGCTGCTCAGATTCGCGACGGTCTCCTCCAGGCTAGAGTCTAG
AA sequence
>Lus10004268 pacid=23177790 polypeptide=Lus10004268 locus=Lus10004268.g ID=Lus10004268.BGIv1.0 annot-version=v1.0
MGNLLCCVQVDQSTVAIKERFGKFEEVLEPGCHCLPWFLGSQVSGNLSLRVQQLDVRCETKTKDNVFVTVVASIQYRALAERANDAYYKLSNTRGQIQAY
VFDVIRASVPKLSLDDTFEQKNDIAKAVEDELEKAMSHYGYEIVQTLIVDIEPDEHVKRAMNEINAAARMRMAANDKAEAEKILQIKRAEGEAESKYLSG
LGIARQRQAIVDGLRDSVLGFSENVPGTSARDVMDMVLVTQYFDTMKEIGATSKSSAVFIPHGPGAVRDVAAQIRDGLLQARV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G62740 AtHIR4, ATHIR1 hypersensitive induced reactio... Lus10004268 0 1
AT5G04550 Protein of unknown function (D... Lus10028839 1.0 0.8780
AT1G61820 BGLU46 beta glucosidase 46 (.1.3) Lus10018353 1.4 0.8471
AT4G01400 unknown protein Lus10012607 3.0 0.8231
AT3G53810 Concanavalin A-like lectin pro... Lus10040773 3.7 0.8003
AT2G13680 GLS2, ATGSL02, ... ARABIDOPSIS THALIANA GLUCAN SY... Lus10002096 5.3 0.8229
AT1G53570 MAPKKK3, MAP3KA MAP KINASE KINASE KINASE 3, mi... Lus10000829 8.4 0.7828
AT1G66350 GRAS RGL1 RGA-like 1 (.1) Lus10036932 9.2 0.6910
AT2G15890 MEE14 maternal effect embryo arrest ... Lus10012044 10.2 0.8146
AT2G40410 Staphylococcal nuclease homolo... Lus10040967 10.7 0.8016
AT2G17480 ATMLO8, MLO8 MILDEW RESISTANCE LOCUS O 8, S... Lus10022096 11.1 0.7362

Lus10004268 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.