Lus10004272 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G58420 472 / 5e-171 Ribosomal protein S4 (RPS4A) family protein (.1)
AT2G17360 472 / 7e-171 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
AT5G07090 472 / 7e-171 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019239 508 / 8e-176 AT2G22660 747 / 0.0 Protein of unknown function (duplicated DUF1399) (.1), Protein of unknown function (duplicated DUF1399) (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G103700 473 / 4e-171 AT5G58420 465 / 3e-168 Ribosomal protein S4 (RPS4A) family protein (.1)
Potri.016G124100 472 / 7e-171 AT5G58420 458 / 2e-165 Ribosomal protein S4 (RPS4A) family protein (.1)
Potri.015G033700 470 / 4e-170 AT5G07090 468 / 3e-169 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
Potri.015G079600 466 / 1e-168 AT5G07090 460 / 4e-166 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
Potri.013G011000 464 / 7e-168 AT2G17360 452 / 6e-163 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08071 RS4NT RS4NT (NUC023) domain
CL0492 S4 PF01479 S4 S4 domain
CL0107 KOW PF00467 KOW KOW motif
CL0021 OB PF00900 Ribosomal_S4e Ribosomal family S4e
Representative CDS sequence
>Lus10004272 pacid=23163595 polypeptide=Lus10004272 locus=Lus10004272.g ID=Lus10004272.BGIv1.0 annot-version=v1.0
ATGGCGAGGGGTTTGAAGAAGCACTTGAAGAGGCTCAATGCTCCCAAGCATTGGATGCTCGACAAGCTCGGCGGCGCTTTCGCTCCTAAGCCTTCATCTG
GGCCGCACAAGTCTAGGGAGTGCCTTCCTTTGGTTCTTATTCTGCGAAACAGGTTGAAGTACGCTTTGACCTACCGTGAGGTTCAGTCCATCTTGATGCA
GCGTCATGTGATGGTTGATAACAAGGTCAGGACTGATAAGACCTTCCCAGCTGGGTTTATGGATGTGGTCTCCATCCCCAAGACCAATGAGAATTTCCGT
CTGCTGTATGATACCAAGGGAAGGTTCAGACTGCACTCCATCCGTGATGAGGAGGCAAAGTTCAAGCTGTGCAAGGTCAGGAACATCCAATTCGGTTCCA
AGGGTATCCCATACCTAAATACCTATGATGGCCGCACCATCCGCTACCCCGACCCGCTCATCAAGGCTAACGACACCATCAAGCTGGACCTCGATTCCAC
TAAGATTGTTGACTTCATCAAGTTTGACGTTGGCAACGTTGTCATGGTCACCGGAGGCAGGAACAGAGGCCGAGTCGGGATCCTGAAGAACAGAGAGAAG
CATAAGGGAAGCATCGAGACAGTCCACATCCAGGACTCTACTGGTCACGAGTTTGCCACTCTTCTGTCCAATGTTTTCACCATCGGCAAGGGTTCCAAGC
CCTGGGTGTCTCTCCCCAAGGGCAAGGGTATCAAGCTTACCATCATTGAGGAGGCCAAGAAGAGGATTGCTGCTCAGGCTGCTGCTTAG
AA sequence
>Lus10004272 pacid=23163595 polypeptide=Lus10004272 locus=Lus10004272.g ID=Lus10004272.BGIv1.0 annot-version=v1.0
MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYREVQSILMQRHVMVDNKVRTDKTFPAGFMDVVSIPKTNENFR
LLYDTKGRFRLHSIRDEEAKFKLCKVRNIQFGSKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSTKIVDFIKFDVGNVVMVTGGRNRGRVGILKNREK
HKGSIETVHIQDSTGHEFATLLSNVFTIGKGSKPWVSLPKGKGIKLTIIEEAKKRIAAQAAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G58420 Ribosomal protein S4 (RPS4A) f... Lus10004272 0 1
AT4G36130 Ribosomal protein L2 family (.... Lus10028468 1.4 0.9630
AT1G18080 RACK1A_AT, ATAR... RECEPTOR FOR ACTIVATED C KINAS... Lus10017569 2.0 0.9596
AT3G05590 RPL18 ribosomal protein L18 (.1) Lus10031485 2.2 0.9563
AT4G36130 Ribosomal protein L2 family (.... Lus10041923 2.8 0.9605
AT3G57490 Ribosomal protein S5 family pr... Lus10014909 3.0 0.9599
AT3G03060 P-loop containing nucleoside t... Lus10031211 3.5 0.9456
AT5G48760 Ribosomal protein L13 family p... Lus10043151 4.7 0.9392
AT2G42740 RPL16A ribosomal protein large subuni... Lus10029824 5.3 0.9441
AT5G04800 Ribosomal S17 family protein (... Lus10041076 5.5 0.9397
AT3G57490 Ribosomal protein S5 family pr... Lus10009952 5.7 0.9421

Lus10004272 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.