Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10265 112 / 5e-34 Wound-responsive family protein (.1) AT4G10270 107 / 3e-32 Wound-responsive family protein (.1) AT4G33560 54 / 9e-11 Wound-responsive family protein (.1) AT2G14070 47 / 9e-08 wound-responsive protein-related (.1) AT4G05070 39 / 5e-05 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039761 [exp] 145 / 3e-47 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10039754 [exp] 145 / 3e-47 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10018532 [exp] 142 / 8e-46 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10039755 [exp] 138 / 3e-44 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10018533 [exp] 130 / 5e-41 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10039760 [exp] 120 / 3e-37 AT4G10265 120 / 3e-37 Wound-responsive family protein (.1) Lus10018531 [exp] 119 / 6e-37 AT4G10265 119 / 1e-36 Wound-responsive family protein (.1) Lus10039753 [exp] 118 / 2e-36 AT4G10265 120 / 4e-37 Wound-responsive family protein (.1) Lus10039751 [exp] 118 / 3e-36 AT4G10265 113 / 1e-34 Wound-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G117632 [exp] 108 / 2e-32 AT4G10270 98 / 3e-28 Wound-responsive family protein (.1) Potri.019G116866 [exp] 107 / 3e-32 AT4G10270 80 / 3e-21 Wound-responsive family protein (.1) Potri.019G116932 [exp] 107 / 4e-32 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117100 [exp] 107 / 4e-32 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117500 [exp] 107 / 4e-32 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117402 [exp] 107 / 4e-32 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117201 [exp] 107 / 5e-32 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G117301 [exp] 105 / 2e-31 AT4G10270 79 / 5e-21 Wound-responsive family protein (.1) Potri.019G117200 [exp] 104 / 6e-31 AT4G10270 79 / 1e-20 Wound-responsive family protein (.1) Potri.019G117700 [exp] 101 / 8e-30 AT4G10265 89 / 5e-25 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10004297 pacid=23163594 polypeptide=Lus10004297 locus=Lus10004297.g ID=Lus10004297.BGIv1.0 annot-version=v1.0 ATGAGTTCAACAAGCAAAGCATGGATGGTGGCAGCAAGTATTGGAGCAGTGGAGGCACTCAAGGACCAACTTGGTTTCTGCAGATGGAATTATATCCTCC GATCTGCTAATCAATATGCCAAGAGCAACGTCAGATCCATCTCATCACAGGCTAAGAACATCCCTCCTTCTTCCTCTGCAGCGGTGGTTTCAAGTAAATT GAAGGAGGCTCAACAGTCTGAAGAGTCGTTGAGGAAAGTTATGTACTTGAGCTGTTGGGGTCCTTGCTGA
AA sequence Show only first row Show all	>Lus10004297 pacid=23163594 polypeptide=Lus10004297 locus=Lus10004297.g ID=Lus10004297.BGIv1.0 annot-version=v1.0 MSSTSKAWMVAASIGAVEALKDQLGFCRWNYILRSANQYAKSNVRSISSQAKNIPPSSSAAVVSSKLKEAQQSEESLRKVMYLSCWGPC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G10265			Wound-responsive family protei...		Lus10004297 [exp]	0	1
AT2G19940			oxidoreductases, acting on the...		Lus10034096 [exp]	1.4	0.7980
AT1G65450			HXXXD-type acyl-transferase fa...		Lus10038184 [exp]	9.5	0.6853
AT4G39260		ATGRP8, CCR1, G...	glycine-rich RNA-binding prote...		Lus10026343 [exp]	16.1	0.7172
AT5G51060		ATRBOHC, RHD2	ROOT HAIR DEFECTIVE 2, A. THAL...		Lus10022434 [exp]	19.5	0.7714
AT3G19895			RING/U-box superfamily protein...		Lus10034201 [exp]	20.5	0.7551
AT3G52730			ubiquinol-cytochrome C reducta...		Lus10021364 [exp]	22.1	0.7670
AT3G14130			Aldolase-type TIM barrel famil...		Lus10008133 [exp]	22.4	0.7130
AT2G42610		LSH10	LIGHT SENSITIVE HYPOCOTYLS 10,...		Lus10029219 [exp]	24.2	0.7902
AT3G07970		QRT2	QUARTET 2, Pectin lyase-like s...		Lus10029511 [exp]	28.4	0.6533
AT1G21450	GRAS	SCL1	SCARECROW-like 1 (.1)		Lus10042776 [exp]	29.9	0.7654

Compare expression of checked genes

Lus10004297 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.