Lus10004303 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G13600 128 / 5e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G62890 119 / 6e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G08070 119 / 1e-30 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G21090 115 / 9e-30 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT2G20540 114 / 2e-29 MEF21 mitochondrial editing factor 21 (.1)
AT3G22690 113 / 1e-28 unknown protein
AT4G37380 110 / 9e-28 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G37170 108 / 3e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G44230 108 / 4e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G08305 108 / 4e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003383 371 / 2e-132 AT2G21090 145 / 1e-40 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10019213 353 / 2e-120 AT2G21090 376 / 2e-123 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10011025 195 / 3e-64 AT2G13600 77 / 1e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10004114 153 / 1e-47 AT3G13880 96 / 5e-24 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10014009 147 / 6e-45 AT3G13880 89 / 2e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030125 139 / 2e-38 AT2G20540 618 / 0.0 mitochondrial editing factor 21 (.1)
Lus10017386 124 / 8e-34 AT5G08305 357 / 9e-120 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10010183 125 / 2e-33 AT5G08305 529 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10020918 116 / 6e-30 AT2G29760 474 / 3e-159 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G091600 125 / 5e-33 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.018G035900 122 / 3e-32 AT2G20540 709 / 0.0 mitochondrial editing factor 21 (.1)
Potri.002G175900 118 / 8e-31 AT5G08510 608 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G073100 114 / 2e-29 AT5G08305 600 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G012600 114 / 3e-29 AT2G29760 540 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G245300 114 / 5e-29 AT3G22690 570 / 0.0 unknown protein
Potri.003G031600 114 / 7e-29 AT3G15930 784 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G088600 113 / 1e-28 AT1G31430 690 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.005G035900 113 / 1e-28 AT1G74630 884 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G369900 112 / 1e-28 AT5G66520 512 / 2e-175 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10004303 pacid=23163620 polypeptide=Lus10004303 locus=Lus10004303.g ID=Lus10004303.BGIv1.0 annot-version=v1.0
ATGGTTTCAATGGATCCTGCCTCGGTAATCGACGAATATGGAAGTTTACTATCGACATGCATCACATCCAGGAACCTCAAATTGGGCAAGGCAATTCATT
CCAACTTCATCAAAACCGCGATCAACTTCAACTCCTTCGTCGTTAATCGTCTAATCGACATGTACTCCAAATGCAGTTCTATCGGATCCGCCCATAAGGC
CTTCGACGATCTCCCCTTCAAGAACGCTCGTTCCTGGAACACCATCGTCTCCGCCTGCTCCAAATTGGGTATGGTGAAAATGGCGCGGAAACTGTTCGAT
GAAATGCCTGACCGAAATCTCGTCAGCTACAACTCAATGATTTCGGGGCTTTCTCGTGGTGGGTATTACAAGGAGGCGTTGGGTATGTTCATGAGATTGC
AGGAAGATTGCGTTGGGGGGTTTTGTTTGGATGACTTTACTGTTGTGAGTGTGGTGAGTTGTTGTGCGAGCTTTCGTGGGTTGGAATTGGTTCGTCAGCT
GCATGGTGTGGGATTAGTTGTTGGGTTGGAAGGGAATGTGGTGTTGCTGAACTCTGTGGTTGATGCTTATGGGAAATGTGGGGAACCTGATGTTAGTTTC
CGTGTATTTAGCAGGATGAATGACAGGGATGTTGTGTCGTGGACGTCAATGTTGTGTCGTGGACGTTAA
AA sequence
>Lus10004303 pacid=23163620 polypeptide=Lus10004303 locus=Lus10004303.g ID=Lus10004303.BGIv1.0 annot-version=v1.0
MVSMDPASVIDEYGSLLSTCITSRNLKLGKAIHSNFIKTAINFNSFVVNRLIDMYSKCSSIGSAHKAFDDLPFKNARSWNTIVSACSKLGMVKMARKLFD
EMPDRNLVSYNSMISGLSRGGYYKEALGMFMRLQEDCVGGFCLDDFTVVSVVSCCASFRGLELVRQLHGVGLVVGLEGNVVLLNSVVDAYGKCGEPDVSF
RVFSRMNDRDVVSWTSMLCRGR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G21090 Pentatricopeptide repeat (PPR-... Lus10004303 0 1
AT5G01110 Tetratricopeptide repeat (TPR)... Lus10022401 1.4 0.8926
AT4G13650 Pentatricopeptide repeat (PPR)... Lus10018978 4.9 0.8845
AT1G27590 unknown protein Lus10007229 6.9 0.8987
AT1G28690 Tetratricopeptide repeat (TPR)... Lus10015308 7.5 0.8611
AT4G16835 Tetratricopeptide repeat (TPR)... Lus10003382 10.3 0.8402
AT3G52140 tetratricopeptide repeat (TPR)... Lus10037481 11.1 0.8768
AT1G06710 Tetratricopeptide repeat (TPR)... Lus10025532 12.5 0.8658
AT3G04160 unknown protein Lus10021982 13.7 0.8599
AT1G20230 Pentatricopeptide repeat (PPR)... Lus10006815 14.3 0.8258
AT3G26540 Tetratricopeptide repeat (TPR)... Lus10032922 21.0 0.8599

Lus10004303 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.