Lus10004304 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G11290 123 / 2e-32 CRR22 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G24000 122 / 3e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G20230 120 / 1e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G08510 118 / 4e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G16470 117 / 7e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G44230 118 / 8e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G16835 115 / 8e-30 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G14820 115 / 1e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G30700 114 / 1e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G14850 114 / 2e-29 MEF11, LOI1 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003382 315 / 3e-110 AT4G16835 212 / 2e-64 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10019213 305 / 1e-101 AT2G21090 376 / 2e-123 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10006815 288 / 3e-101 AT1G20230 116 / 6e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10010850 120 / 3e-31 AT5G60020 856 / 0.0 laccase 17 (.1)
Lus10013991 119 / 3e-31 AT3G57430 632 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015414 119 / 4e-31 AT3G57430 629 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10024381 119 / 6e-31 AT3G23330 777 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10008967 119 / 7e-31 AT4G21300 876 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10020743 117 / 1e-30 AT1G04840 771 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G220300 132 / 1e-35 AT1G11290 559 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G119000 128 / 3e-34 AT5G44230 792 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G077700 125 / 1e-33 AT4G30700 489 / 1e-164 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G059400 123 / 2e-32 AT4G18750 1110 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G001200 122 / 2e-32 AT3G24000 798 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G191000 122 / 2e-32 AT1G11290 1178 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G104700 121 / 6e-32 AT2G13600 834 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G010100 119 / 9e-32 AT4G16470 551 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G125500 120 / 2e-31 AT3G29230 829 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G044700 120 / 2e-31 AT3G22690 582 / 0.0 unknown protein
PFAM info
Representative CDS sequence
>Lus10004304 pacid=23163627 polypeptide=Lus10004304 locus=Lus10004304.g ID=Lus10004304.BGIv1.0 annot-version=v1.0
ATGGCTCTGTTCGATTTCAAGTCTAACAACCACTTTGTTGCATCCTCAGACGGAGCCAACCTCCAAATCTACGAGTTAATCAACCTCACCGTTAACATTC
CTTCCATAAAAAAGATTCACTGGGTCTTGGTTGATTTATTAGGTAGGAAAAACAGACTGAGCGAAGCGATGGAGTTAGTCGAAAAAACTCCTGGTCTATC
GGAGCATGCGGGGATATGGGGCGCTCTATTAGGTGCTTGTCGGATCCATCACAATGTGGGTCTTGCCATGAAGGCTGCGGAAACTCTATTCAAATTAGAA
CCCGGGAATCCTGGAAGATGTGTCATGTTAGCGAATGTTTATACATCAGCTAATAAATGGAGTGATGCTTCAAGAATGAGAAGGGAAGTGGATGAAAAAG
GTCTAGTTAAAGATGTAGCTTACAGTAGGATTGAGGTGAGGAATGAGAGGCATGAGTTTGTGGCCAAGGACAAGGCTCACAGACAGATACAAGAAGTATA
TGAAGCAATCCCTCGACTACTTGATCATATGAGGGAAGCTGGACACTGGCCTTCCACAAATGACTTTGGATCGTCGGAGAAGATGATGTCCTAG
AA sequence
>Lus10004304 pacid=23163627 polypeptide=Lus10004304 locus=Lus10004304.g ID=Lus10004304.BGIv1.0 annot-version=v1.0
MALFDFKSNNHFVASSDGANLQIYELINLTVNIPSIKKIHWVLVDLLGRKNRLSEAMELVEKTPGLSEHAGIWGALLGACRIHHNVGLAMKAAETLFKLE
PGNPGRCVMLANVYTSANKWSDASRMRREVDEKGLVKDVAYSRIEVRNERHEFVAKDKAHRQIQEVYEAIPRLLDHMREAGHWPSTNDFGSSEKMMS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G11290 CRR22 CHLORORESPIRATORY REDUCTION22,... Lus10004304 0 1
AT2G21090 Pentatricopeptide repeat (PPR-... Lus10019213 1.0 0.8810
AT1G54130 AT-RSH3, RSH3, ... RELA/SPOT homolog 3 (.1) Lus10008755 2.8 0.8220
Lus10000458 6.9 0.7667
AT3G20440 EMB2729, BE1 EMBRYO DEFECTIVE 2729, BRANCHI... Lus10000912 7.6 0.8372
AT2G01130 DEA(D/H)-box RNA helicase fami... Lus10007938 9.2 0.8173
AT5G04050 RNA-directed DNA polymerase (r... Lus10036278 10.6 0.7990
AT1G74600 OTP87 organelle transcript processin... Lus10002054 11.7 0.8284
Lus10042563 12.0 0.7996
AT3G27730 MER3, RCK ROCK-N-ROLLERS, ATP binding;AT... Lus10032137 15.0 0.7635
AT5G23200 unknown protein Lus10010192 15.6 0.7862

Lus10004304 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.