Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G12410 209 / 2e-67 EMB3146, CLP2, NCLPP2, CLPR2 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) AT5G23140 119 / 9e-33 NCLPP7, NCLPP2, CLPP2 nuclear-encoded CLP protease P7 (.1) ATCG00670 115 / 1e-31 PCLPP, ATCG00670.1, CLPP1 CASEINOLYTIC PROTEASE P 1, plastid-encoded CLP P (.1) AT1G11750 103 / 2e-26 NCLPP6, NCLPP1, CLPP6 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) AT1G66670 100 / 4e-25 NCLPP3, NCLPP4, CLPP3 CLP protease proteolytic subunit 3 (.1) AT1G02560 100 / 5e-25 NCLPP5, NCLPP1, CLPP5 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) AT4G17040 92 / 1e-21 HON5, CLPR4 happy on norflurazon 5, CLP protease R subunit 4 (.1) AT5G45390 88 / 2e-20 NCLPP3, NCLPP4, CLPP4 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) AT1G09130 67 / 8e-13 ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.1), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.2), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.3) AT1G49970 67 / 9e-13 SVR2, NCLPP5, CLPR1 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028905 [exp] 444 / 6e-160 AT1G12410 268 / 5e-90 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) Lus10017397 [exp] 119 / 9e-33 AT5G23140 394 / 1e-140 nuclear-encoded CLP protease P7 (.1) Lus10010196 [exp] 119 / 2e-32 AT5G23140 395 / 4e-141 nuclear-encoded CLP protease P7 (.1) Lus10040982 [exp] 113 / 7e-30 AT5G23140 338 / 5e-118 nuclear-encoded CLP protease P7 (.1) Lus10013434 [exp] 103 / 2e-26 AT5G23140 347 / 3e-121 nuclear-encoded CLP protease P7 (.1) Lus10040981 [exp] 103 / 2e-26 AT5G23140 350 / 1e-122 nuclear-encoded CLP protease P7 (.1) Lus10011282 [exp] 97 / 6e-24 AT1G11750 300 / 2e-102 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Lus10040477 [exp] 97 / 1e-23 AT1G11750 305 / 2e-104 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Lus10002422 [exp] 92 / 4e-22 AT1G02560 361 / 4e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G115900 [exp] 227 / 4e-74 AT1G12410 408 / 3e-145 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) Potri.005G092600 [exp] 121 / 1e-33 AT5G23140 380 / 3e-135 nuclear-encoded CLP protease P7 (.1) Potri.007G071700 [exp] 121 / 5e-33 AT5G23140 383 / 1e-135 nuclear-encoded CLP protease P7 (.1) Potri.004G152900 [exp] 111 / 2e-29 AT1G11750 397 / 4e-141 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.009G114001 [exp] 104 / 7e-27 AT1G11750 353 / 2e-123 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.004G092100 [exp] 101 / 3e-25 AT1G66670 441 / 2e-156 CLP protease proteolytic subunit 3 (.1) Potri.002G195200 [exp] 100 / 4e-25 AT1G02560 474 / 2e-170 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.014G119700 [exp] 100 / 5e-25 AT1G02560 493 / 6e-178 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.003G103300 [exp] 93 / 2e-22 AT5G45390 383 / 9e-135 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Potri.003G083300 [exp] 86 / 9e-20 AT4G17040 441 / 2e-157 happy on norflurazon 5, CLP protease R subunit 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0127 [flax] [poplar] ClpP_crotonase PF00574 [flax] [poplar] CLP_protease Clp protease
Representative CDS sequence Show only first row Show all	>Lus10004319 pacid=23161716 polypeptide=Lus10004319 locus=Lus10004319.g ID=Lus10004319.BGIv1.0 annot-version=v1.0 ATGGCGTCCACGCTGAATACTAACGTTCATCAACCTTCTCTCAGGATTCGAAACTCCAAACAGCCAGCAGTCATCGAAATGAGTTTCGGTGGTACACCAC GCGTACTCAGTAAAACTCCTGGGGAGAATTCTGTGCAATATGTTGATGTGTATACAGCCCTTCAAAGGAGGAGAATAATCTTTGTCCCTCGGTCGATCAA TACACAATACAGCAACAAATTATTGGGGGTAATGTTGTATCTTGATAGCGTCGACGATACCAAAAGGATGTATTTCTACTTTAATGGCCCTGGTGGAGAT CTTAGTCCCAGCTTAATTATCTACGATGCTATGAAGGCCTTGAGCAGTCCTATTGGTACCCACTGCATAGGGTATTCATATAATATGGCAACTTTTATGA TTGCAGCTGGAGACAAAGGATATCGATCGGGAATGCCTAACTGTAGGCTGACTCTAGAAGCTCCTGCTGGTGCAGCTCGTGGCGAGGCAGATGCGATGAA AGCCGAGAGAGATGAACTTGTTAGAATCAAGAATTATCTTTACCAGGAGTTCTCGAAGAACACCGGACAGCCAGTTGAGAAGATTGAAGAGGACATGAAG AGAGGGGGTCTAGTCTTGAAATCTCAGCAGGCCATGGACTATGGCATCATAGACAAAATAGTCCGACCTCAAAGTATCGTTAACGACGTTGTTGACAACC AAAACAGCTCACCTTGGTCATCGCCTCCTGGTTATCATTAG
AA sequence Show only first row Show all	>Lus10004319 pacid=23161716 polypeptide=Lus10004319 locus=Lus10004319.g ID=Lus10004319.BGIv1.0 annot-version=v1.0 MASTLNTNVHQPSLRIRNSKQPAVIEMSFGGTPRVLSKTPGENSVQYVDVYTALQRRRIIFVPRSINTQYSNKLLGVMLYLDSVDDTKRMYFYFNGPGGD LSPSLIIYDAMKALSSPIGTHCIGYSYNMATFMIAAGDKGYRSGMPNCRLTLEAPAGAARGEADAMKAERDELVRIKNYLYQEFSKNTGQPVEKIEEDMK RGGLVLKSQQAMDYGIIDKIVRPQSIVNDVVDNQNSSPWSSPPGYH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G12410		EMB3146, CLP2, ...	NUCLEAR-ENCODED CLP PROTEASE P...		Lus10004319 [exp]	0	1
AT5G66470			RNA binding;GTP binding (.1)		Lus10014289 [exp]	2.4	0.9730
AT5G40160		EMB139, EMB506	embryo defective 506, EMBRYO D...		Lus10032165 [exp]	3.0	0.9440
AT3G12930			Lojap-related protein (.1)		Lus10002544 [exp]	3.9	0.9356
AT1G71720		PDE338	PIGMENT DEFECTIVE 338, Nucleic...		Lus10028726 [exp]	4.2	0.9466
AT3G57810			Cysteine proteinases superfami...		Lus10020438 [exp]	5.2	0.9242
AT4G32320		APX6	ascorbate peroxidase 6 (.1)		Lus10002916 [exp]	5.7	0.9563
AT1G78630		EMB1473	embryo defective 1473, Ribosom...		Lus10005553 [exp]	6.5	0.9572
AT5G55220			trigger factor type chaperone ...		Lus10010250 [exp]	6.7	0.9473
AT3G17170		RFC3	REGULATOR OF FATTY-ACID COMPOS...		Lus10017084 [exp]	8.9	0.9163
AT5G26880		AGL26	AGAMOUS-like 26 (.1.2)		Lus10015701 [exp]	10.5	0.9194

Compare expression of checked genes

Lus10004319 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.