Lus10004327 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G62760 158 / 2e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25260 137 / 2e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62360 127 / 2e-36 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 123 / 1e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62350 115 / 6e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 112 / 2e-30 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G01610 111 / 4e-30 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G51520 110 / 7e-30 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25250 108 / 2e-29 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62770 101 / 2e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028910 333 / 3e-117 AT1G62760 169 / 1e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10024595 187 / 1e-59 AT1G62760 141 / 6e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10032232 182 / 5e-58 AT1G62760 141 / 9e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038915 133 / 9e-39 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031138 130 / 1e-37 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031711 123 / 7e-35 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027199 120 / 1e-33 AT5G62360 169 / 3e-53 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031133 119 / 2e-33 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031713 119 / 3e-33 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G119300 172 / 3e-54 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113600 166 / 1e-51 AT1G62760 171 / 1e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128100 138 / 7e-41 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 135 / 8e-40 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127400 134 / 3e-39 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128200 134 / 3e-39 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128700 130 / 7e-38 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127500 128 / 5e-37 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113700 121 / 4e-34 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1)
Potri.015G128900 116 / 2e-32 AT4G25250 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10004327 pacid=23161747 polypeptide=Lus10004327 locus=Lus10004327.g ID=Lus10004327.BGIv1.0 annot-version=v1.0
ATGGGAACTTTGGCAGCAATTTTCTTTCTCTTCTTCCTTACCCAGACAATCATCACTCCAACCGCCGCAAACCCACCGCCGGAATCCTCCGGAAGGTTAA
ACCCAGACGCGGAATTCATCAAAGCTTCTTGCAATTCAACCCTCTACCCTAATCGCTGCTACATAACCCTGTCCCCTTACGCCTCCGAAATCGGATCCGA
CCCAAGGAAACTGTCCCTGAAAGCTCTCAACGTGACCTTAAAAGTCACGAATTCCGCTTCAAGGCTGATGAAGAGGATGTCCAGAATGAAAGGTCTGCAG
CCCCGGATGGCGGCGGCGGTGGCAGACTGCGTGGAGGAGGTCGGCGACGCGGTGGAGGAGCTCGGGAACTCGGTCGCCGAGATGGGCGGGTCGTCGCCCA
TTCAGGGACCCGACTTCTGCCGGATGATTTCCGATGTTCAGACTTGGGTCAGCGCGGCGGAAACCGACGATGACACCTGTACGGACGGGTTCGACGAGGA
GCCGGCGGCGGCGGAGGAGGGGGAAAAGAGTTCGGTGGTGGTGAGTAGAAATGTGAAGAAGATAGTTGAGAGACACGTGGCGAGGATTTCTCGGTTTACT
AGTAACGCTCTGGCTCTGGTGAATCTCTATGCTTCTTCTTCCGAATCTAGTCATGTTCCTTGTTGA
AA sequence
>Lus10004327 pacid=23161747 polypeptide=Lus10004327 locus=Lus10004327.g ID=Lus10004327.BGIv1.0 annot-version=v1.0
MGTLAAIFFLFFLTQTIITPTAANPPPESSGRLNPDAEFIKASCNSTLYPNRCYITLSPYASEIGSDPRKLSLKALNVTLKVTNSASRLMKRMSRMKGLQ
PRMAAAVADCVEEVGDAVEELGNSVAEMGGSSPIQGPDFCRMISDVQTWVSAAETDDDTCTDGFDEEPAAAEEGEKSSVVVSRNVKKIVERHVARISRFT
SNALALVNLYASSSESSHVPC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G62760 Plant invertase/pectin methyle... Lus10004327 0 1
AT5G44005 unknown protein Lus10003609 2.4 0.8715
AT3G55370 DOF OBP3, AtDof3. 6 OBF-binding protein 3 (.1.2.3) Lus10016566 4.0 0.8858
AT3G55370 DOF OBP3, AtDof3. 6 OBF-binding protein 3 (.1.2.3) Lus10005956 7.1 0.8822
AT5G08391 Protein of unknown function (D... Lus10032032 9.8 0.8593
AT5G35740 Carbohydrate-binding X8 domain... Lus10039059 10.4 0.8809
AT1G70280 NHL domain-containing protein ... Lus10032158 10.6 0.8637
AT1G10380 Putative membrane lipoprotein ... Lus10036687 10.8 0.8828
AT4G05220 Late embryogenesis abundant (L... Lus10006755 12.4 0.8788
AT1G77690 LAX3 like AUX1 3 (.1) Lus10028078 12.6 0.8310
AT5G62670 AHA11 H\(+\)-ATPase 11, H\(+\)-ATPas... Lus10003259 12.8 0.7951

Lus10004327 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.