Lus10004329 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64950 238 / 3e-75 Mitochondrial transcription termination factor family protein (.1)
AT5G07900 143 / 5e-39 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 141 / 4e-38 Mitochondrial transcription termination factor family protein (.1)
AT1G62010 99 / 1e-22 Mitochondrial transcription termination factor family protein (.1)
AT1G62120 98 / 3e-22 Mitochondrial transcription termination factor family protein (.1)
AT1G62150 96 / 1e-21 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 92 / 3e-20 Mitochondrial transcription termination factor family protein (.1.2)
AT1G61990 91 / 6e-20 Mitochondrial transcription termination factor family protein (.1)
AT1G61980 89 / 3e-19 Mitochondrial transcription termination factor family protein (.1)
AT3G46950 80 / 3e-16 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028912 671 / 0 AT5G64950 249 / 1e-79 Mitochondrial transcription termination factor family protein (.1)
Lus10029199 483 / 3e-171 AT5G64950 226 / 1e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10010714 179 / 1e-53 AT4G38840 117 / 3e-33 SAUR-like auxin-responsive protein family (.1)
Lus10008688 171 / 1e-49 AT5G07900 197 / 2e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10036450 137 / 1e-36 AT5G07900 176 / 3e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 126 / 1e-32 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10041122 125 / 2e-32 AT5G07900 166 / 2e-47 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 124 / 7e-32 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 119 / 5e-30 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G190300 167 / 4e-48 AT5G07900 209 / 8e-64 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034700 166 / 2e-47 AT5G07900 202 / 2e-61 Mitochondrial transcription termination factor family protein (.1)
Potri.003G190400 162 / 2e-46 AT5G07900 206 / 9e-63 Mitochondrial transcription termination factor family protein (.1)
Potri.004G222000 162 / 2e-46 AT5G07900 200 / 1e-60 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034933 160 / 1e-45 AT5G07900 194 / 3e-58 Mitochondrial transcription termination factor family protein (.1)
Potri.001G029400 157 / 4e-44 AT5G07900 181 / 4e-53 Mitochondrial transcription termination factor family protein (.1)
Potri.014G133200 156 / 7e-44 AT5G07900 436 / 3e-152 Mitochondrial transcription termination factor family protein (.1)
Potri.001G030300 156 / 8e-44 AT5G07900 190 / 2e-56 Mitochondrial transcription termination factor family protein (.1)
Potri.003G190700 154 / 4e-43 AT5G07900 213 / 3e-65 Mitochondrial transcription termination factor family protein (.1)
Potri.003G189300 150 / 1e-41 AT5G07900 178 / 6e-52 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10004329 pacid=23161729 polypeptide=Lus10004329 locus=Lus10004329.g ID=Lus10004329.BGIv1.0 annot-version=v1.0
ATGGCGATGCTATCTCTCTCAACTTACCGTCTCAGCAATCTACGATTCGGGGCTTGCTTCTCTACACTCGCCGAGTCCTCCTCAGCTGCATCAACCTCCT
CTTCCCTAGTGGATTGCTTGATTGCAACCTTCAAATTCACCGACACCCAAGCCAACTCCATCGCCGCTCGCTTCTCCGATTCCAAATCTCCTACAAAACC
CCAAGCCTTATCCCAATTCCTTCGCGGCCAGGGTTTCACCGATGCCCACATACAAGCTACAGTTTCCGGAGCACCTCAGATTCTATTTGCCAACATTGAC
ACGAATCTTAAACCCAAGATCCAGCATTTCCGAAAACTAGGCCTCGAGGGTTCTCGTCTTTGTAAGTTCCTCTCGAAAAATCCCACGATTTTGACTGCTA
GTTTGAAGGAGAAGTTAGGCCCTCGACTTGAAATTTTGCAGAAATCCATCTCTCAGAAGGATTTAGCTAGGGGTGTAGAGAGGTGCAGTTGGGTTCTGTA
TAAGTACTCTGAATCTAGACTGTTGTCGAACACTGCATTGCTCCAGAGCTGTGGCATTGTCGGCTCTCAGCTCTCGATGCTGTTCAGGATGCAGCCCAGG
ATGTTCTTGAGGGAAGAATCTGAACTTAGAGGCATTGTTTCCAGGACTTTGGATTTCGGGTTCTCCACAAAATCTAAGATGTTTGTACACGGTTTGTACA
CTGTCGGCGGATGGAGTGACGCTGCCCTCGAGAGAAAATTCGCCATCTTCGACGGGTTTGGATTCTCCAGGGAAGAATGTATCGGCATGTTCAGAAAGGC
ACCAGTGTTGCTGAGATGCTCCGAGGAGAAGTTGAAGTTTGGGATTGGTTTCTATTTGAACACAATGAAGCTGAACAAAGAGATGATCTGCAGAAGGCCT
TCGCTGTTGATGTATAGCATGGCGGAAAGAGTGATCCCTCGATACCGTGTTTTGGAGATTATGGAGTCGAAGGGGCTGTTTCAGAAGAGGCCGAACTTCA
TCACTGTTGCGAGTCTGACGAATGAGAGGTTTGTCGAGAAGTTTGTGTTTTGGTCCGTGGATCATGCAGAGGAACTACTGATGGTTTACAATGGTCATGA
TGTCAGTGCTGCTAGAGATGAAACAAGTTTATAG
AA sequence
>Lus10004329 pacid=23161729 polypeptide=Lus10004329 locus=Lus10004329.g ID=Lus10004329.BGIv1.0 annot-version=v1.0
MAMLSLSTYRLSNLRFGACFSTLAESSSAASTSSSLVDCLIATFKFTDTQANSIAARFSDSKSPTKPQALSQFLRGQGFTDAHIQATVSGAPQILFANID
TNLKPKIQHFRKLGLEGSRLCKFLSKNPTILTASLKEKLGPRLEILQKSISQKDLARGVERCSWVLYKYSESRLLSNTALLQSCGIVGSQLSMLFRMQPR
MFLREESELRGIVSRTLDFGFSTKSKMFVHGLYTVGGWSDAALERKFAIFDGFGFSREECIGMFRKAPVLLRCSEEKLKFGIGFYLNTMKLNKEMICRRP
SLLMYSMAERVIPRYRVLEIMESKGLFQKRPNFITVASLTNERFVEKFVFWSVDHAEELLMVYNGHDVSAARDETSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G64950 Mitochondrial transcription te... Lus10004329 0 1
AT3G57610 ADSS, ATPURA adenylosuccinate synthase (.1) Lus10040512 1.7 0.9135
AT3G23940 dehydratase family (.1.2) Lus10033370 2.2 0.8911
AT3G62660 GATL7 galacturonosyltransferase-like... Lus10001461 3.7 0.8681
AT5G07900 Mitochondrial transcription te... Lus10041122 5.3 0.9038
AT5G06770 C3HZnF KH domain-containing protein /... Lus10021043 7.1 0.8582
AT5G28740 Tetratricopeptide repeat (TPR)... Lus10041573 7.5 0.8941
AT5G64950 Mitochondrial transcription te... Lus10028912 9.1 0.8277
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Lus10032962 10.7 0.8943
AT3G49080 Ribosomal protein S5 domain 2-... Lus10014970 11.8 0.8733
AT3G56550 Pentatricopeptide repeat (PPR)... Lus10041326 11.8 0.8792

Lus10004329 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.