Lus10004330 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G24620 183 / 1e-59 EF hand calcium-binding protein family (.1)
AT5G37770 108 / 1e-30 CML24, TCH2 TOUCH 2, CALMODULIN-LIKE 24, EF hand calcium-binding protein family (.1)
AT1G66400 108 / 1e-30 CML23 calmodulin like 23 (.1)
AT1G73630 102 / 4e-28 EF hand calcium-binding protein family (.1)
AT1G18210 100 / 3e-27 Calcium-binding EF-hand family protein (.1.2)
AT2G27030 88 / 1e-22 CAM5, CAM2, ACAM-2, ACAM-5 calmodulin 5 (.1.2.3)
AT1G66410 88 / 1e-22 ACAM-4, CAM4 calmodulin 4 (.1.2)
AT5G21274 88 / 1e-22 ACAM-6, CAM6 calmodulin 6 (.1)
AT5G37780 88 / 1e-22 ACAM-1, TCH1, CAM1 TOUCH 1, calmodulin 1 (.1.2.3)
AT3G43810 87 / 2e-22 CAM7 calmodulin 7 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028913 267 / 3e-93 AT1G24620 204 / 5e-68 EF hand calcium-binding protein family (.1)
Lus10029660 150 / 2e-47 AT1G24620 102 / 3e-28 EF hand calcium-binding protein family (.1)
Lus10024574 144 / 9e-45 AT1G24620 143 / 4e-44 EF hand calcium-binding protein family (.1)
Lus10019863 100 / 3e-27 AT2G15680 233 / 9e-79 calmodulin-like 30, Calcium-binding EF-hand family protein (.1)
Lus10009127 100 / 2e-26 AT1G66400 147 / 2e-44 calmodulin like 23 (.1)
Lus10018012 98 / 2e-26 AT1G18210 195 / 2e-64 Calcium-binding EF-hand family protein (.1.2)
Lus10014050 97 / 1e-25 AT2G15680 239 / 4e-81 calmodulin-like 30, Calcium-binding EF-hand family protein (.1)
Lus10009059 94 / 1e-24 AT1G18210 197 / 3e-65 Calcium-binding EF-hand family protein (.1.2)
Lus10031345 92 / 4e-24 AT1G18210 196 / 1e-64 Calcium-binding EF-hand family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G107100 197 / 4e-65 AT1G24620 220 / 2e-73 EF hand calcium-binding protein family (.1)
Potri.008G134300 194 / 6e-64 AT1G24620 219 / 2e-73 EF hand calcium-binding protein family (.1)
Potri.015G039500 103 / 2e-28 AT1G18210 189 / 6e-62 Calcium-binding EF-hand family protein (.1.2)
Potri.012G048200 102 / 2e-28 AT1G18210 188 / 8e-62 Calcium-binding EF-hand family protein (.1.2)
Potri.004G089400 98 / 1e-26 AT1G66400 157 / 7e-50 calmodulin like 23 (.1)
Potri.017G126200 96 / 9e-26 AT1G66400 155 / 5e-49 calmodulin like 23 (.1)
Potri.014G070700 97 / 1e-25 AT1G18210 94 / 2e-24 Calcium-binding EF-hand family protein (.1.2)
Potri.012G041000 89 / 6e-23 AT5G37780 283 / 9e-100 TOUCH 1, calmodulin 1 (.1.2.3)
Potri.001G222200 89 / 1e-22 AT2G27030 304 / 6e-107 calmodulin 5 (.1.2.3)
Potri.015G032600 88 / 1e-22 AT5G37780 284 / 3e-100 TOUCH 1, calmodulin 1 (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0220 EF_hand PF00036 EF-hand_1 EF hand
Representative CDS sequence
>Lus10004330 pacid=23161730 polypeptide=Lus10004330 locus=Lus10004330.g ID=Lus10004330.BGIv1.0 annot-version=v1.0
ATGAACTGCCACGCCTCCGAGCTAGACCAGGTCTTCAAGAAGTTCGACGTCAATGGCGACGGCAAGATCTCCGCCTCCGAGCTGGGCATGATCATGTCCA
GTCTCGGCCACAGGGCCAACGACGACGAGCTCCAGAAGATGATCACCGAGTTCGACGCCGACGGGGACGGGTTCATCGATTTCGACGAGTTCGTGGCCAT
GAACACCCAGGGGGTCGGGTCCGAGGAGGCCATGGTGAATCTGAGGCACGCGTTTTCCGTGTACGACATCGACGGCAACGGGTCGATCACCGCCGAGGAG
CTGCACAAGGTGATGATCAGCTTGGGGGAAGAGTGCTCGATTGCAGAGTGCAGGAAGATGATCAGCGGCGTGGATCGGGACGGCAACGGGACGATCGATT
TCGAGGAGTTTAAGATGATGATGACTATGGGTTCCAGGTGGGGTTCTTCCGAGCAGTGA
AA sequence
>Lus10004330 pacid=23161730 polypeptide=Lus10004330 locus=Lus10004330.g ID=Lus10004330.BGIv1.0 annot-version=v1.0
MNCHASELDQVFKKFDVNGDGKISASELGMIMSSLGHRANDDELQKMITEFDADGDGFIDFDEFVAMNTQGVGSEEAMVNLRHAFSVYDIDGNGSITAEE
LHKVMISLGEECSIAECRKMISGVDRDGNGTIDFEEFKMMMTMGSRWGSSEQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G24620 EF hand calcium-binding protei... Lus10004330 0 1
AT3G62580 Late embryogenesis abundant pr... Lus10025037 7.9 0.8035
AT5G58375 Methyltransferase-related prot... Lus10008585 14.4 0.8345
AT5G13810 Glutaredoxin family protein (.... Lus10039537 15.4 0.8175
AT4G13010 Oxidoreductase, zinc-binding d... Lus10003159 17.6 0.8131
AT2G31305 INH3 inhibitor-3 (.1) Lus10018105 24.2 0.7056
AT1G55910 ZIP11 zinc transporter 11 precursor ... Lus10004413 25.1 0.7925
AT5G47120 ATBI-1, ATBI1 ARABIDOPSIS BAX INHIBITOR 1, B... Lus10000097 28.3 0.7817
AT4G32020 unknown protein Lus10005344 32.5 0.8144
AT5G60570 Galactose oxidase/kelch repeat... Lus10037413 37.0 0.8103
AT5G13860 ELC-LIKE, ATELC... ELCH-like (.1) Lus10041612 37.8 0.8030

Lus10004330 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.