Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12480 100 / 1e-27 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 98 / 3e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 98 / 3e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G62510 97 / 2e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 96 / 5e-26 AZI1 azelaic acid induced 1 (.1) AT1G12090 94 / 1e-25 ELP extensin-like protein (.1) AT4G12500 94 / 4e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12490 94 / 6e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 88 / 3e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G46890 82 / 9e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004348 [exp] 116 / 4e-34 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024626 [exp] 115 / 1e-33 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028929 [exp] 114 / 3e-33 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 113 / 6e-33 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1) Lus10032259 [exp] 105 / 4e-30 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024623 [exp] 104 / 2e-29 AT4G12490 152 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024620 [exp] 101 / 7e-28 AT4G12490 150 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032257 [exp] 100 / 7e-28 AT4G12490 157 / 1e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024621 [exp] 98 / 2e-26 AT4G12490 147 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G121900 [exp] 104 / 2e-29 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G158400 [exp] 102 / 5e-29 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 101 / 2e-28 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 82 / 9e-21 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 80 / 4e-20 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 78 / 2e-19 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 77 / 5e-19 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.006G008500 [exp] 72 / 2e-16 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.006G008300 [exp] 72 / 5e-16 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.013G128800 [exp] 67 / 4e-15 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10004346 pacid=23161724 polypeptide=Lus10004346 locus=Lus10004346.g ID=Lus10004346.BGIv1.0 annot-version=v1.0 ATGGCTTCCAAAACCAACTCAGCCCTAGCTCTCTTCCTTGCACTCAACCTTCTCTTCTTCTCCATGGCCTCCGCTTGCGGTGGTGGCTGCCCTACCCCGA AACCAAAACCGAAACCAACTCCCACTCCCACTCCTTCCGGCGGTGGGAAATGCCCGATTGATGCCCTCAAGTTGGGAGTGTGTGCCGACGTGCTTGGCTC ACTGTTGAAGCTCAAAATCGGAAACCCACCGGTCAAGCCTTGTTGCAGTTTGATTAATGGACTTGTCGATCTCGAGGCTGCTGTTTGTCTTTGCACTGCC ATCAAAGCTAACCTTCTCGGGATCAACCTCAATGTTCCGCTTTCTCTTAGCTTGCTTCTCAATGTTTGCGAGAAGAAGGTCCCATCTGGCTTCCAGTGCC CTTGA
AA sequence Show only first row Show all	>Lus10004346 pacid=23161724 polypeptide=Lus10004346 locus=Lus10004346.g ID=Lus10004346.BGIv1.0 annot-version=v1.0 MASKTNSALALFLALNLLFFSMASACGGGCPTPKPKPKPTPTPTPSGGGKCPIDALKLGVCADVLGSLLKLKIGNPPVKPCCSLINGLVDLEAAVCLCTA IKANLLGINLNVPLSLSLLLNVCEKKVPSGFQCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10004346 [exp]	0	1
AT5G57770			Plant protein of unknown funct...		Lus10015501 [exp]	2.8	0.9290
AT1G27660	bHLH	bHLH110	basic helix-loop-helix (bHLH) ...		Lus10025987 [exp]	3.0	0.9383
AT4G01240			S-adenosyl-L-methionine-depend...		Lus10035135 [exp]	4.6	0.9273
AT3G48280		CYP71A25	"cytochrome P450, family 71, s...		Lus10002885 [exp]	5.5	0.9207
AT4G23430		AtTic32-IVa	translocon at the inner envelo...		Lus10032282 [exp]	6.3	0.9327
AT5G61830			NAD(P)-binding Rossmann-fold s...		Lus10001968 [exp]	8.7	0.9289
AT1G22340		ATUGT85A7	UDP-glucosyl transferase 85A7 ...		Lus10004670 [exp]	9.8	0.9308
AT5G05320			FAD/NAD(P)-binding oxidoreduct...		Lus10025068 [exp]	11.5	0.9277
AT4G15560		AtCLA1, DXS, DX...	1-DEOXY-D-XYLULOSE 5-PHOSPHATE...		Lus10002663 [exp]	12.8	0.9204
AT1G54650			Methyltransferase family prote...		Lus10006576 [exp]	14.7	0.9210

Compare expression of checked genes

Lus10004346 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.