Lus10004349 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G62500 114 / 1e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G10940 92 / 5e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT3G22142 82 / 5e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT3G22120 77 / 1e-16 CWLP cell wall-plasma membrane linker protein (.1)
AT4G15160 75 / 1e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT1G12100 64 / 4e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12470 62 / 5e-12 AZI1 azelaic acid induced 1 (.1)
AT4G12510 61 / 5e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12520 61 / 5e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G12090 60 / 2e-11 ELP extensin-like protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028930 134 / 8e-39 AT1G62500 141 / 4e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032262 121 / 2e-33 AT1G62500 162 / 3e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10010482 82 / 2e-20 AT3G22142 162 / 5e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10003801 84 / 3e-19 AT3G22142 168 / 7e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10027704 82 / 3e-19 AT2G10940 135 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10001493 69 / 8e-15 AT1G62510 111 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032259 68 / 2e-14 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10004346 66 / 9e-14 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10024625 65 / 2e-13 AT4G12520 158 / 5e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G111300 121 / 1e-33 AT1G62500 125 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G065500 98 / 4e-25 AT2G10940 147 / 8e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.018G126000 98 / 6e-24 AT2G10940 109 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.006G008500 84 / 5e-20 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1)
Potri.016G015500 87 / 9e-20 AT3G22142 161 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G008300 82 / 8e-19 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.018G025900 66 / 6e-14 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G121900 67 / 8e-14 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G121800 66 / 1e-13 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.003G111400 65 / 3e-13 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10004349 pacid=23161718 polypeptide=Lus10004349 locus=Lus10004349.g ID=Lus10004349.BGIv1.0 annot-version=v1.0
ATGGCTTCTTCTTCAAAACTAATAGCCTTGATATTCATCTCCATGCATTTCATTCTAATCTCCTTGCCTCCTATTTACTCTTGTGTCCCTTGCACTCACC
CAAAACCAAAACCAAACCCAAACCCACCCTCTCACTCTCACTCTCCTCCATCATCCGGCCACCGTCCACATCCCCCCACCACCAGCCCACCCCACCACGG
CGGGGGCCGCGGTGGTCACCATGGTAAAGGCAAAGGCAAAGGCAAAGGAGGTGGCGGAGGTAAAGGGCATAATCGTCCTCCACCAATAGTTTCACCACCC
ATCATAGTCAACCCTCCTCCGGTTACATACCCTCCTCCGGTGGTGACGCCTCCCGTGATAAACCCTCCACCTCCTTCTTCCGTGCCATGTCCTCCTCCGC
CAGCTACGCAACCCACGTGTCCGATCGGAGGGCTGAAGCTAGGAGCGTGCGTGGACGTGCTGGGAGGGTTGGTCCACGTAGGGGTAGGGAACCCGGTGGA
GAATGTGTGCTGTCCGGTGATTAAAGGGCTGCTGGAGATTGAAGCCGCCGTTTGTTTGTGCACGTCCATAAGGCTGAAGCTTCTTAACATCAACATCTTC
ATCCCTTTAGCACTTCAGGCTCTCATCACCTGCGGCAAGACTTCCCCCCCTGGCTTCGTTTGCCCTCCACTTTGA
AA sequence
>Lus10004349 pacid=23161718 polypeptide=Lus10004349 locus=Lus10004349.g ID=Lus10004349.BGIv1.0 annot-version=v1.0
MASSSKLIALIFISMHFILISLPPIYSCVPCTHPKPKPNPNPPSHSHSPPSSGHRPHPPTTSPPHHGGGRGGHHGKGKGKGKGGGGGKGHNRPPPIVSPP
IIVNPPPVTYPPPVVTPPVINPPPPSSVPCPPPPATQPTCPIGGLKLGACVDVLGGLVHVGVGNPVENVCCPVIKGLLEIEAAVCLCTSIRLKLLNINIF
IPLALQALITCGKTSPPGFVCPPL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G62500 Bifunctional inhibitor/lipid-t... Lus10004349 0 1
AT1G62500 Bifunctional inhibitor/lipid-t... Lus10028930 3.9 0.8813
AT2G40435 unknown protein Lus10009089 7.1 0.8512
AT2G40550 ETG1 E2F target gene 1 (.1) Lus10030540 8.8 0.8942
AT4G31810 ATP-dependent caseinolytic (Cl... Lus10010685 22.6 0.8910
AT5G42960 unknown protein Lus10007162 23.5 0.8900
AT4G11610 NTRB, ATNTRB C2 calcium/lipid-binding plant... Lus10031816 25.9 0.8792
AT5G39550 ORTH1, VIM3 VARIANT IN METHYLATION 3, ORTH... Lus10039127 30.3 0.8805
AT1G80670 RAE1 RNA export factor 1, Transduci... Lus10002323 33.6 0.8857
AT3G05510 Phospholipid/glycerol acyltran... Lus10020650 42.4 0.8577
AT5G40200 DEGP9 DegP protease 9 (.1) Lus10014524 43.8 0.8700

Lus10004349 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.