Lus10004351 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16515 43 / 4e-06 RGF6 root meristem growth factor 6, unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028932 137 / 4e-42 ND 44 / 1e-06
Lus10008506 49 / 5e-08 AT4G16515 47 / 2e-08 root meristem growth factor 6, unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G122600 43 / 2e-05 AT4G16515 45 / 9e-07 root meristem growth factor 6, unknown protein
PFAM info
Representative CDS sequence
>Lus10004351 pacid=23161731 polypeptide=Lus10004351 locus=Lus10004351.g ID=Lus10004351.BGIv1.0 annot-version=v1.0
ATGTCTGGAGTTCTGGCGTGGCTACTGCTCGCTTCTCTTTCGGTGCATGCATGCACTGCTCGGAAACTCATCGTTCACGGCGAAGCTAGCAGTGATGTTA
CCGTTTTCAGTTCAACGTCGTCGGAAGACGAAGCCGGAACACAAGATGTAGACGGGAGTTTGCTCGGTGCAATTACGTCCTGCATCAAGCACAGTCTACT
TGGTGGTCATCCTTTGAAGCAGGAGAAAGATGATAAAATAAAAGAGGGGATGAAGAAGACGTGGAGAGGAAGAGCTCTAATTGCAGGGAAGAATATGAAT
ATGAAGAAGAAGAAGAAATCCAATGTTAGTGGAGACGAGGCAGAAGAAGAAGAAGAAGAGGAGAATACTAGTATTGTTATGATGGACTATGCTCAGCCCC
ATCGAAAGCCCCCAATCCACAACGAAAAACACTGA
AA sequence
>Lus10004351 pacid=23161731 polypeptide=Lus10004351 locus=Lus10004351.g ID=Lus10004351.BGIv1.0 annot-version=v1.0
MSGVLAWLLLASLSVHACTARKLIVHGEASSDVTVFSSTSSEDEAGTQDVDGSLLGAITSCIKHSLLGGHPLKQEKDDKIKEGMKKTWRGRALIAGKNMN
MKKKKKSNVSGDEAEEEEEEENTSIVMMDYAQPHRKPPIHNEKH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10004351 0 1
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10000843 2.0 1.0000
Lus10002413 3.0 1.0000
Lus10022996 3.5 1.0000
Lus10003843 3.5 1.0000
AT3G11180 2-oxoglutarate (2OG) and Fe(II... Lus10023602 3.7 1.0000
Lus10001326 3.7 1.0000
Lus10033373 5.3 1.0000
AT5G04350 Plant self-incompatibility pro... Lus10029383 5.7 1.0000
AT5G35750 AHK2 histidine kinase 2 (.1) Lus10009736 5.9 1.0000
AT1G07985 Expressed protein (.1) Lus10029516 6.0 1.0000

Lus10004351 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.