Lus10004352 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G45170 179 / 4e-59 ATATG8E AUTOPHAGY 8E (.1.2)
AT4G16520 177 / 2e-58 ATG8F autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
AT1G62040 174 / 4e-57 ATG8C autophagy 8c, Ubiquitin-like superfamily protein (.1.2)
AT3G60640 171 / 5e-56 ATG8G AUTOPHAGY 8G, Ubiquitin-like superfamily protein (.1)
AT2G05630 169 / 3e-55 ATG8D Ubiquitin-like superfamily protein (.1.2)
AT4G21980 167 / 3e-54 ATG8A, APG8A AUTOPHAGY-RELATED 8A, AUTOPHAGY 8A, Ubiquitin-like superfamily protein (.1.2)
AT4G04620 163 / 4e-53 ATG8B autophagy 8b, Ubiquitin-like superfamily protein (.1.2)
AT3G15580 121 / 2e-36 APG8H, ATG8I AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1)
AT3G06420 116 / 2e-34 ATG8H autophagy 8h, Ubiquitin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028933 197 / 4e-66 AT4G16520 215 / 6e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
Lus10008507 185 / 1e-61 AT4G16520 216 / 3e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
Lus10000733 183 / 7e-61 AT4G16520 217 / 1e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
Lus10015563 172 / 3e-56 AT1G62040 230 / 1e-79 autophagy 8c, Ubiquitin-like superfamily protein (.1.2)
Lus10027186 168 / 6e-55 AT2G05630 222 / 1e-76 Ubiquitin-like superfamily protein (.1.2)
Lus10039656 164 / 2e-52 AT2G05630 203 / 6e-68 Ubiquitin-like superfamily protein (.1.2)
Lus10038046 120 / 9e-36 AT3G15580 199 / 1e-67 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1)
Lus10009987 112 / 2e-29 AT3G62240 625 / 0.0 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G136040 187 / 2e-62 AT4G16520 197 / 1e-66 autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
Potri.003G110901 187 / 2e-62 AT4G16520 197 / 1e-66 autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
Potri.001G122700 186 / 4e-62 AT4G16520 191 / 2e-64 autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
Potri.002G144600 181 / 4e-60 AT3G60640 192 / 8e-65 AUTOPHAGY 8G, Ubiquitin-like superfamily protein (.1)
Potri.014G060300 180 / 1e-59 AT4G16520 214 / 1e-73 autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
Potri.002G228800 171 / 6e-56 AT2G05630 224 / 1e-77 Ubiquitin-like superfamily protein (.1.2)
Potri.014G153800 169 / 2e-55 AT2G05630 202 / 6e-69 Ubiquitin-like superfamily protein (.1.2)
Potri.004G013700 164 / 2e-53 AT1G62040 216 / 3e-74 autophagy 8c, Ubiquitin-like superfamily protein (.1.2)
Potri.011G004300 162 / 4e-52 AT4G21980 219 / 1e-74 AUTOPHAGY-RELATED 8A, AUTOPHAGY 8A, Ubiquitin-like superfamily protein (.1.2)
Potri.008G099400 121 / 2e-36 AT3G15580 187 / 7e-63 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Representative CDS sequence
>Lus10004352 pacid=23161741 polypeptide=Lus10004352 locus=Lus10004352.g ID=Lus10004352.BGIv1.0 annot-version=v1.0
ATGCTCCCCTCTTCGAATTATAGTAGGGGTGACTCTAATAAAACTGAATCACTAGTCAGCTGGATGATTCAGCAGCTTGAGCACCAAGATAGAGAGAAGA
GAAAGGCTGAGGCTGCCAGGATAAGGGAGAAGTACCCAGATAGAATTCCGGTCATTGTGGAGAAGGCGGAGAGAAGTGAAATACCAAACATAGACAAGAA
AAAGTACCTAGTCCCATCTGACTTGACTGTCGGACAGTTTGTTTACGTAATCCGAAAGAGGATCAAATTGAGTGCTGAAAAGGCAATCTTCATATTCGTG
GACAATGTCCTGCCACCAACCGGTGCTATAATGTCTGCAATATATGAAGAAAAGAAGGATGAAGACGGATTTCTCTATGTTACTTACAGCGGCGAGAATA
CTTTCGGAGTGGAGATTCATCAGTAG
AA sequence
>Lus10004352 pacid=23161741 polypeptide=Lus10004352 locus=Lus10004352.g ID=Lus10004352.BGIv1.0 annot-version=v1.0
MLPSSNYSRGDSNKTESLVSWMIQQLEHQDREKRKAEAARIREKYPDRIPVIVEKAERSEIPNIDKKKYLVPSDLTVGQFVYVIRKRIKLSAEKAIFIFV
DNVLPPTGAIMSAIYEEKKDEDGFLYVTYSGENTFGVEIHQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G45170 ATATG8E AUTOPHAGY 8E (.1.2) Lus10004352 0 1
AT3G27010 TCP ATTCP20, PCF1, ... ARABIDOPSIS THALIANA TEOSINTE ... Lus10035193 2.8 0.9042
AT1G71340 AtGDPD4 glycerophosphodiester phosphod... Lus10013777 4.0 0.8833
AT3G56460 GroES-like zinc-binding alcoho... Lus10028988 4.2 0.8924
AT2G42780 unknown protein Lus10031380 6.0 0.8910
AT3G27010 TCP ATTCP20, PCF1, ... ARABIDOPSIS THALIANA TEOSINTE ... Lus10032022 6.0 0.8763
AT5G09850 Transcription elongation facto... Lus10003853 6.5 0.9091
AT2G24550 unknown protein Lus10020142 8.7 0.9100
AT5G26990 Drought-responsive family prot... Lus10015214 8.7 0.8719
AT5G39360 EDL2 EID1-like 2 (.1) Lus10018196 10.2 0.8756
AT1G15740 Leucine-rich repeat family pro... Lus10038107 10.9 0.9114

Lus10004352 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.