Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35736 95 / 5e-28 unknown protein AT4G25225 78 / 2e-21 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028935 [exp] 119 / 7e-38 AT2G35736 96 / 2e-28 unknown protein Lus10000732 [exp] 79 / 1e-21 AT2G35736 73 / 1e-19 unknown protein Lus10027209 [exp] 73 / 2e-19 AT4G25225 82 / 8e-23 unknown protein Lus10038922 [exp] 74 / 3e-19 AT4G25225 81 / 2e-21 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G123000 [exp] 97 / 9e-29 AT2G35736 91 / 1e-26 unknown protein Potri.001G124100 [exp] 83 / 3e-23 AT4G25225 90 / 6e-26 unknown protein Potri.014G059600 [exp] 74 / 7e-20 AT4G25225 87 / 8e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004354 pacid=23161717 polypeptide=Lus10004354 locus=Lus10004354.g ID=Lus10004354.BGIv1.0 annot-version=v1.0 ATGGGGATCCTGAGGAGCGGGTTCTCGTTTATACTCGGCACGTCGTTCGGCATCTACCTTGCTCAGAACTACAACGTCCCTAACGTACGCAAGCTCGCCA ACACCGGGATGGTTATCGCCAAACACATCGAGGAGTCGTATAGGAAGCCCAAGAAGACTGACGTTGACGATTGA
AA sequence Show only first row Show all	>Lus10004354 pacid=23161717 polypeptide=Lus10004354 locus=Lus10004354.g ID=Lus10004354.BGIv1.0 annot-version=v1.0 MGILRSGFSFILGTSFGIYLAQNYNVPNVRKLANTGMVIAKHIEESYRKPKKTDVDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G35736			unknown protein		Lus10004354 [exp]	0	1
AT2G31570		ATGPX2	glutathione peroxidase 2 (.1)		Lus10027021 [exp]	12.1	0.9014
AT5G19930			Protein of unknown function DU...		Lus10033068 [exp]	12.3	0.8950
AT4G14880		OLD3, CYTACS1, ...	ONSET OF LEAF DEATH 3, O-acety...		Lus10015947 [exp]	14.7	0.8919
AT3G57090		FIS1A, BIGYIN	FISSION 1A, Tetratricopeptide ...		Lus10036023 [exp]	15.8	0.9001
AT5G53560		B5#2, ATB5-A, A...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Lus10022357 [exp]	20.0	0.8967
AT1G26270			Phosphatidylinositol 3- and 4-...		Lus10000012 [exp]	22.2	0.8540
AT1G80180			unknown protein		Lus10030064 [exp]	27.7	0.8922
AT4G25225			unknown protein		Lus10027209 [exp]	28.6	0.8795
AT1G49310			unknown protein		Lus10040476 [exp]	43.8	0.8766
AT2G46950		CYP709B2	"cytochrome P450, family 709, ...		Lus10025756 [exp]	63.5	0.8633

Compare expression of checked genes

Lus10004354 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.