Lus10004363 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G03070 89 / 3e-24 NADH-ubiquinone oxidoreductase-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039147 94 / 4e-26 AT3G03070 154 / 5e-50 NADH-ubiquinone oxidoreductase-related (.1)
Lus10013785 94 / 3e-24 AT3G18110 296 / 3e-91 embryo defective 1270, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10021654 76 / 3e-18 ND /
Lus10029513 78 / 4e-18 AT3G63520 901 / 0.0 carotenoid cleavage dioxygenase 1 (.1)
Lus10012669 57 / 6e-11 ND /
Lus10010847 39 / 0.0003 ND 40 / 6e-04
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G082100 93 / 6e-26 AT3G03070 153 / 1e-49 NADH-ubiquinone oxidoreductase-related (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0045 Rubredoxin PF10276 zf-CHCC Zinc-finger domain
Representative CDS sequence
>Lus10004363 pacid=23151919 polypeptide=Lus10004363 locus=Lus10004363.g ID=Lus10004363.BGIv1.0 annot-version=v1.0
ATGGAGTTGAACAATGAGATTCCTCCCATCAAGGTTGAAGGAAGGATTACCGCTTGTGAAGGGGATACCAACCCTGCACTTGGACATCCAATTGAGTTCA
TCTGCCTGGACTTGAAGGAGCCAGCAGTGTGCAAGCTAACTAGATTTTTTTATGAACGGCGCAAGAAATATGAGGCAGACGTTCGTGTTAATGAATATTG
GACTGAGAGGTGTTGTACAACCACGCGTGAGCGTGGTGTCAATGGACAGACTCACACGGTGCAGGTTTTCGATCACACAGCTGAAGAGTATGATGTTGTT
AGTGCATAA
AA sequence
>Lus10004363 pacid=23151919 polypeptide=Lus10004363 locus=Lus10004363.g ID=Lus10004363.BGIv1.0 annot-version=v1.0
MELNNEIPPIKVEGRITACEGDTNPALGHPIEFICLDLKEPAVCKLTRFFYERRKKYEADVRVNEYWTERCCTTTRERGVNGQTHTVQVFDHTAEEYDVV
SA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G03070 NADH-ubiquinone oxidoreductase... Lus10004363 0 1

Lus10004363 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.