Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G60730 87 / 4e-21 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2), NAD(P)-linked oxidoreductase superfamily protein (.3) AT1G10810 86 / 4e-21 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G60680 86 / 6e-21 AGD2 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G60690 83 / 7e-20 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G60750 83 / 7e-20 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G60710 79 / 3e-18 ATB2 NAD(P)-linked oxidoreductase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023701 [exp] 111 / 2e-30 AT1G60690 527 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10041272 [exp] 90 / 2e-22 AT1G60710 571 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10037437 [exp] 89 / 5e-22 AT1G60690 571 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10041303 [exp] 83 / 4e-20 AT1G60690 419 / 1e-148 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10006105 [exp] 81 / 4e-19 AT1G60690 554 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10041185 [exp] 66 / 2e-13 AT1G60750 384 / 2e-133 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10041184 [exp] 64 / 4e-13 AT1G60690 374 / 1e-129 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10037408 [exp] 63 / 8e-13 AT1G60730 311 / 6e-106 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2), NAD(P)-linked oxidoreductase superfamily protein (.3) Lus10029615 [exp] 64 / 9e-13 AT1G60710 399 / 2e-139 NAD(P)-linked oxidoreductase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G147700 [exp] 90 / 2e-22 AT1G60710 559 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.002G234000 [exp] 85 / 9e-21 AT1G60690 524 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.002G234201 [exp] 81 / 5e-19 AT1G60710 547 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.008G158300 [exp] 70 / 4e-15 AT1G60680 389 / 2e-135 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.005G052400 [exp] 66 / 7e-14 AT1G60680 395 / 1e-137 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.013G040000 [exp] 66 / 8e-14 AT1G60710 376 / 2e-130 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.013G040100 [exp] 66 / 8e-14 AT1G60710 369 / 1e-127 NAD(P)-linked oxidoreductase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004399 pacid=23163078 polypeptide=Lus10004399 locus=Lus10004399.g ID=Lus10004399.BGIv1.0 annot-version=v1.0 ATGAAGCTGGGTTCGCAAGGTCTGGGATGTATGGGTAGACCTCCAAAACCAGACCCCGATATGATCCATCTCATCCACCACACCCTCAACTCCGGCCTCA CTCTCCTCGATACTGCCCTCATACTTGGAAAGTATCTACCAAGGTTCCAGCAGGGGAATATAGAACACAATGCAGCTGTATTCGAGAGGGTGAATGAGAT GGCAAGTAGAAAAAGGTGCACCCCGTCGCAACTGGTGCTTGCTTGGGTGCATCATCAGGGAGAGGATGTGAGCCCGATTCCGGGGCCACCAAAGTTGACA ACTTCAATCATAACGTTGGAGCTTTGTCTGTGCTGCTGGAGATGCAGTCAAGGGTGA
AA sequence Show only first row Show all	>Lus10004399 pacid=23163078 polypeptide=Lus10004399 locus=Lus10004399.g ID=Lus10004399.BGIv1.0 annot-version=v1.0 MKLGSQGLGCMGRPPKPDPDMIHLIHHTLNSGLTLLDTALILGKYLPRFQQGNIEHNAAVFERVNEMASRKRCTPSQLVLAWVHHQGEDVSPIPGPPKLT TSIITLELCLCCWRCSQG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G60680		AGD2	NAD(P)-linked oxidoreductase s...		Lus10004399 [exp]	0	1
AT2G40600			appr-1-p processing enzyme fam...		Lus10029040 [exp]	1.4	0.9846
AT3G59710			NAD(P)-binding Rossmann-fold s...		Lus10035736 [exp]	2.4	0.9841
AT5G39150			RmlC-like cupins superfamily p...		Lus10033767 [exp]	4.0	0.9651
					Lus10031841 [exp]	6.0	0.9719
AT2G42010		PLDBETA1	phospholipase D beta 1 (.1)		Lus10014146 [exp]	6.5	0.9775
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10032641 [exp]	7.1	0.9679
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Lus10037585 [exp]	7.4	0.9671
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10020493 [exp]	9.9	0.9555
AT1G29860	WRKY	ATWRKY71, WRKY7...	WRKY DNA-binding protein 71 (....		Lus10004537 [exp]	11.0	0.9599
AT1G18140		LAC1, ATLAC1	laccase 1 (.1)		Lus10040936 [exp]	12.4	0.9658

Compare expression of checked genes

Lus10004399 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.