Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G13520 52 / 6e-11 SMAP1 small acidic protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023702 [exp] 83 / 3e-23 AT4G13520 48 / 2e-09 small acidic protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G174000 [exp] 64 / 1e-15 AT4G13520 54 / 2e-11 small acidic protein 1 (.1) Potri.010G063100 [exp] 63 / 2e-15 AT4G13520 51 / 2e-10 small acidic protein 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004400 pacid=23163082 polypeptide=Lus10004400 locus=Lus10004400.g ID=Lus10004400.BGIv1.0 annot-version=v1.0 ATGAGGCCGATGCAGATGGATTTCTTTACAGACATGGAGGAGCAAGGGTCGTCGGTGGCGATGGACGTCGACGACGTGGATCCGCTCGAGATCTTCAACG AAGGCATGTTGAACGATAGCAAGCTCGTCGACGCCGATTTCTTCAACAGATTCGAGGATGATTTCGATGACTCGGACATCAACTAA
AA sequence Show only first row Show all	>Lus10004400 pacid=23163082 polypeptide=Lus10004400 locus=Lus10004400.g ID=Lus10004400.BGIv1.0 annot-version=v1.0 MRPMQMDFFTDMEEQGSSVAMDVDDVDPLEIFNEGMLNDSKLVDADFFNRFEDDFDDSDIN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G13520		SMAP1	small acidic protein 1 (.1)		Lus10004400 [exp]	0	1
AT5G19490	CCAAT		Histone superfamily protein (....		Lus10026780 [exp]	1.4	0.8768
AT5G52840			NADH-ubiquinone oxidoreductase...		Lus10014951 [exp]	2.8	0.8260
					Lus10001297 [exp]	8.1	0.7762
AT2G05630		ATG8D	Ubiquitin-like superfamily pro...		Lus10039656 [exp]	10.5	0.8442
AT4G40042			Microsomal signal peptidase 12...		Lus10037011 [exp]	11.0	0.7233
AT1G54250		NRPE8A, NRPB8A,...	RNA polymerase Rpb8 (.1)		Lus10039177 [exp]	12.2	0.7835
AT3G04670	WRKY	ATWRKY39, WRKY3...	WRKY DNA-binding protein 39 (....		Lus10033857 [exp]	13.3	0.8044
AT5G14680			Adenine nucleotide alpha hydro...		Lus10014545 [exp]	13.5	0.8073
AT3G23100		XRCC4	homolog of human DNA ligase iv...		Lus10022210 [exp]	13.6	0.8252
AT2G31140			Peptidase S24/S26A/S26B/S26C f...		Lus10022921 [exp]	14.9	0.8215

Compare expression of checked genes

Lus10004400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.