Lus10004406 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G04570 109 / 9e-29 Major facilitator superfamily protein (.1)
AT2G33280 103 / 4e-27 Major facilitator superfamily protein (.1)
AT1G64890 76 / 4e-17 Major facilitator superfamily protein (.1)
AT5G54860 51 / 3e-08 Major facilitator superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023708 187 / 5e-58 AT1G04570 451 / 3e-154 Major facilitator superfamily protein (.1)
Lus10024977 76 / 5e-17 AT1G64890 508 / 2e-179 Major facilitator superfamily protein (.1)
Lus10037809 53 / 7e-09 AT5G54860 630 / 0.0 Major facilitator superfamily protein (.1)
Lus10024529 42 / 6e-05 AT1G64890 355 / 2e-120 Major facilitator superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G173600 139 / 1e-39 AT1G04570 502 / 6e-174 Major facilitator superfamily protein (.1)
Potri.010G063800 136 / 1e-38 AT1G04570 523 / 0.0 Major facilitator superfamily protein (.1)
Potri.019G043000 71 / 3e-15 AT1G64890 488 / 3e-171 Major facilitator superfamily protein (.1)
Potri.013G076300 65 / 3e-13 AT1G64890 493 / 3e-173 Major facilitator superfamily protein (.1)
Potri.011G137300 51 / 2e-08 AT5G54860 633 / 0.0 Major facilitator superfamily protein (.1)
Potri.011G137400 50 / 6e-08 AT5G54860 609 / 0.0 Major facilitator superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0015 MFS PF03092 BT1 BT1 family
Representative CDS sequence
>Lus10004406 pacid=23163068 polypeptide=Lus10004406 locus=Lus10004406.g ID=Lus10004406.BGIv1.0 annot-version=v1.0
ATGCAGGCAGGAGGAAGTAGTGGCTTTAGTGGCCAATTGGGTTGGGAACAGATGATTATGTTGTGTGGGTTTGGGTGTTGGATGCAAGGATTTCAGCATA
GGGCCTCCGAATTTCATTGGACGACCCTGGTCGCCAAGCCTCTCTTTGACCTTCTCTCTGATGCTATTTACATTGCTGGAGCTCACAGAATACCCTACAT
TCAAATTGGAGTTTGTTTGCAAGTGTTAGCTTGGGGTTTCTTGGCATTGTTTCCTCCTGCACAGAAAGCTCTTCCTATACTCATGACATGCATCCTTCTA
AGCAACGTTGGTGCTTCAGTCACTAAAGTTGCTACGGATGCTCTTGTTTCCGAGTATGGCCAAAACACAGAATATGCGGCCTCCAATCCTACGCATTCAT
GGCTTTAG
AA sequence
>Lus10004406 pacid=23163068 polypeptide=Lus10004406 locus=Lus10004406.g ID=Lus10004406.BGIv1.0 annot-version=v1.0
MQAGGSSGFSGQLGWEQMIMLCGFGCWMQGFQHRASEFHWTTLVAKPLFDLLSDAIYIAGAHRIPYIQIGVCLQVLAWGFLALFPPAQKALPILMTCILL
SNVGASVTKVATDALVSEYGQNTEYAASNPTHSWL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G04570 Major facilitator superfamily ... Lus10004406 0 1

Lus10004406 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.