Lus10004407 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G33280 135 / 7e-39 Major facilitator superfamily protein (.1)
AT1G04570 134 / 7e-38 Major facilitator superfamily protein (.1)
AT1G64890 80 / 2e-18 Major facilitator superfamily protein (.1)
AT5G54860 61 / 7e-12 Major facilitator superfamily protein (.1)
AT5G25050 51 / 3e-08 Major facilitator superfamily protein (.1)
AT5G25040 49 / 2e-07 Major facilitator superfamily protein (.1.2.3)
AT1G79710 46 / 1e-06 Major facilitator superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023708 183 / 2e-56 AT1G04570 451 / 3e-154 Major facilitator superfamily protein (.1)
Lus10024977 75 / 1e-16 AT1G64890 508 / 2e-179 Major facilitator superfamily protein (.1)
Lus10024529 66 / 1e-13 AT1G64890 355 / 2e-120 Major facilitator superfamily protein (.1)
Lus10037809 57 / 3e-10 AT5G54860 630 / 0.0 Major facilitator superfamily protein (.1)
Lus10041620 54 / 2e-09 AT1G79710 644 / 0.0 Major facilitator superfamily protein (.1)
Lus10017090 53 / 8e-09 AT5G54860 391 / 3e-133 Major facilitator superfamily protein (.1)
Lus10024099 52 / 2e-08 AT1G79710 630 / 0.0 Major facilitator superfamily protein (.1)
Lus10006106 43 / 2e-05 AT2G32040 721 / 0.0 Major facilitator superfamily protein (.1)
Lus10010565 41 / 9e-05 AT2G32040 721 / 0.0 Major facilitator superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G173600 163 / 1e-48 AT1G04570 502 / 6e-174 Major facilitator superfamily protein (.1)
Potri.010G063800 158 / 9e-47 AT1G04570 523 / 0.0 Major facilitator superfamily protein (.1)
Potri.019G043000 89 / 1e-21 AT1G64890 488 / 3e-171 Major facilitator superfamily protein (.1)
Potri.013G076300 86 / 1e-20 AT1G64890 493 / 3e-173 Major facilitator superfamily protein (.1)
Potri.011G137400 66 / 2e-13 AT5G54860 609 / 0.0 Major facilitator superfamily protein (.1)
Potri.011G137300 64 / 8e-13 AT5G54860 633 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G017400 47 / 5e-07 AT5G10820 612 / 0.0 Major facilitator superfamily protein (.1)
Potri.010G085900 46 / 1e-06 AT2G32040 650 / 0.0 Major facilitator superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0015 MFS PF03092 BT1 BT1 family
Representative CDS sequence
>Lus10004407 pacid=23163089 polypeptide=Lus10004407 locus=Lus10004407.g ID=Lus10004407.BGIv1.0 annot-version=v1.0
ATGACCGTTCTCTTTGACCGGTACTGGAAAGAACTTCCCAGGAGAAAACTGGTCGGCACTGTCCAGGTTGTGTATGCTGCTTCACTTCTTCTAGACTTTA
TCCTCATGAGGAAGATCAATGTTAAGATAGGGATTGCCAATGAGTTGTTTGCTCTTTGCTTCTCCTGTTTAGCTGAAACATTCACGCAGTTCAAACTCTT
GTCTTTCTCAATGTTGCTGGCAAGTCTATGCCCGCAAGGATGTGAAGGATCACTGACTTCCTTCTTGGCTTCTGCTTTTGTTCTTTCATCCATCATTAGT
GAATTTCTTGGTGTTCGATGTTGGAGAAATGGTGAAAGGGTGAATGAGAAATTGTATTTCGAGTATCTTGGCAACATCAATCTTGCACTATGA
AA sequence
>Lus10004407 pacid=23163089 polypeptide=Lus10004407 locus=Lus10004407.g ID=Lus10004407.BGIv1.0 annot-version=v1.0
MTVLFDRYWKELPRRKLVGTVQVVYAASLLLDFILMRKINVKIGIANELFALCFSCLAETFTQFKLLSFSMLLASLCPQGCEGSLTSFLASAFVLSSIIS
EFLGVRCWRNGERVNEKLYFEYLGNINLAL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G33280 Major facilitator superfamily ... Lus10004407 0 1
AT3G16180 Major facilitator superfamily ... Lus10009506 5.1 0.8114
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10023215 7.2 0.8114
AT3G14040 Pectin lyase-like superfamily ... Lus10023364 8.8 0.8114
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10027028 10.2 0.8114
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10003281 11.4 0.8114
AT1G21880 LYM1 lysm domain GPI-anchored prote... Lus10006200 12.5 0.8114
Lus10033149 13.5 0.8114
AT1G70690 HWI1, PDLP5 PLASMODESMATA-LOCATED PROTEIN ... Lus10019334 14.4 0.8114
AT1G29430 SAUR-like auxin-responsive pro... Lus10020441 15.3 0.8114
AT1G16445 S-adenosyl-L-methionine-depend... Lus10031751 15.5 0.6953

Lus10004407 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.