Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16400 58 / 2e-11 unknown protein AT3G13175 53 / 4e-10 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016614 [exp] 131 / 7e-41 AT4G16400 86 / 8e-22 unknown protein Lus10038791 [exp] 42 / 5e-06 AT4G16400 78 / 1e-18 unknown protein Lus10039068 [exp] 42 / 6e-06 AT4G16400 81 / 7e-20 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G366900 [exp] 67 / 6e-16 AT3G13175 75 / 4e-19 unknown protein Potri.006G017900 [exp] 59 / 1e-12 AT4G16400 85 / 1e-21 unknown protein Potri.016G007101 [exp] 56 / 1e-11 AT4G16400 96 / 3e-26 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004418 pacid=23163073 polypeptide=Lus10004418 locus=Lus10004418.g ID=Lus10004418.BGIv1.0 annot-version=v1.0 ATGGAGATCCAGCAAAATGTACTCAAATACAAGCTCCACATCATCTCCGCCTTAATCCTATCCCTCCTAATCGCCTCTATAGTCTACCTAGCTCCAAGAT TGGTCACTATCTTGGCCTATTTCTGGCCCCTCTTCATCTCCACAGGCCTCTTCCTAGGCGCCAGCATCTTCATAGGAAAAACCTCCGATTCAGATCCTTC CGCTGACGACAAGGCTTCCGAGGTTTTGCTGGACTACGTCGTCGGACAACCTTCGTCCGTACAAGCCGCCGCGGAGGTGGTCCAGCCCACGGACAGCTTC AAATCTGAACACGATAACCATACCTGA
AA sequence Show only first row Show all	>Lus10004418 pacid=23163073 polypeptide=Lus10004418 locus=Lus10004418.g ID=Lus10004418.BGIv1.0 annot-version=v1.0 MEIQQNVLKYKLHIISALILSLLIASIVYLAPRLVTILAYFWPLFISTGLFLGASIFIGKTSDSDPSADDKASEVLLDYVVGQPSSVQAAAEVVQPTDSF KSEHDNHT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16400			unknown protein		Lus10004418 [exp]	0	1
AT2G44260			Plant protein of unknown funct...		Lus10033542 [exp]	3.5	0.8961
AT5G05960			Bifunctional inhibitor/lipid-t...		Lus10009872 [exp]	10.8	0.8919
AT2G33460		RIC1	ROP-interactive CRIB motif-con...		Lus10041267 [exp]	11.3	0.8983
AT1G26140			unknown protein		Lus10035070 [exp]	16.1	0.8409
AT1G35830			VQ motif-containing protein (....		Lus10024738 [exp]	18.5	0.8619
AT4G29130		GIN2, ATHXK1	GLUCOSE INSENSITIVE 2, ARABIDO...		Lus10038287 [exp]	18.7	0.7967
AT1G22170			Phosphoglycerate mutase family...		Lus10033465 [exp]	19.7	0.8331
AT4G17980	NAC	ANAC071	NAC domain containing protein ...		Lus10035373 [exp]	20.1	0.8784
AT3G51710			D-mannose binding lectin prote...		Lus10025258 [exp]	20.9	0.8832
AT4G01070		UGT72B1, GT72B1	UDP-GLUCOSE-DEPENDENT GLUCOSYL...		Lus10029452 [exp]	28.1	0.8691

Compare expression of checked genes

Lus10004418 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.