Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000319 [exp] 74 / 4e-17 AT3G26040 198 / 2e-58 HXXXD-type acyl-transferase family protein (.1) Lus10004441 [exp] 71 / 8e-16 AT3G26040 196 / 2e-57 HXXXD-type acyl-transferase family protein (.1) Lus10029648 [exp] 48 / 5e-08 AT3G63095 87 / 1e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10012759 [exp] 47 / 1e-07 AT3G26040 209 / 3e-62 HXXXD-type acyl-transferase family protein (.1) Lus10036077 [exp] 46 / 4e-07 AT1G24420 188 / 2e-54 HXXXD-type acyl-transferase family protein (.1) Lus10002893 [exp] 42 / 7e-06 AT5G47950 195 / 2e-57 HXXXD-type acyl-transferase family protein (.1) Lus10036126 [exp] 39 / 9e-05 AT3G26040 189 / 6e-55 HXXXD-type acyl-transferase family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0149 [flax] [poplar] CoA-acyltrans PF02458 [flax] [poplar] Transferase Transferase family
Representative CDS sequence Show only first row Show all	>Lus10004437 pacid=23154276 polypeptide=Lus10004437 locus=Lus10004437.g ID=Lus10004437.BGIv1.0 annot-version=v1.0 ATGACAAATGGAGTTATGGGTATCGATGAAAACTACCTGAATGCAATTTCGGGGATGCGAGGAGACGAGTTCTTGGAAGCATTTACTAGCGGCGGCGCTG CTGCTGCTAAAGGAGCTCTGGTTTGTTCGAGCTGGACTGGGTTTGGTTTTAATGATTTTAACTTTGGGTTAGGAAAGCCCGTTTGGACAGGATTGTTTGG ACATCATAGTGGTCATCACATTGCTTACTAG
AA sequence Show only first row Show all	>Lus10004437 pacid=23154276 polypeptide=Lus10004437 locus=Lus10004437.g ID=Lus10004437.BGIv1.0 annot-version=v1.0 MTNGVMGIDENYLNAISGMRGDEFLEAFTSGGAAAAKGALVCSSWTGFGFNDFNFGLGKPVWTGLFGHHSGHHIAY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10004437 [exp]	0	1
AT5G02910			F-box/RNI-like superfamily pro...		Lus10000727 [exp]	1.0	1.0000
AT2G24370			Protein kinase protein with ad...		Lus10027593 [exp]	2.0	1.0000
AT3G08030			Protein of unknown function, D...		Lus10029502 [exp]	2.4	1.0000
AT3G18170			Glycosyltransferase family 61 ...		Lus10032454 [exp]	2.8	1.0000
					Lus10021739 [exp]	3.2	1.0000
					Lus10039674 [exp]	3.5	1.0000
AT1G30700			FAD-binding Berberine family p...		Lus10031080 [exp]	3.7	1.0000
AT2G26490			Transducin/WD40 repeat-like su...		Lus10032868 [exp]	4.0	1.0000
AT5G17220		GST26, TT19, AT...	TRANSPARENT TESTA 19, GLUTATHI...		Lus10023511 [exp]	5.3	0.9368
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10023445 [exp]	5.7	0.8890

Compare expression of checked genes

Lus10004437 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.