Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26040 56 / 2e-10 HXXXD-type acyl-transferase family protein (.1) AT3G30280 46 / 6e-07 HXXXD-type acyl-transferase family protein (.1) AT5G47950 44 / 5e-06 HXXXD-type acyl-transferase family protein (.1) AT1G24430 43 / 6e-06 HXXXD-type acyl-transferase family protein (.1) AT1G24420 41 / 3e-05 HXXXD-type acyl-transferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004441 [exp] 116 / 6e-32 AT3G26040 196 / 2e-57 HXXXD-type acyl-transferase family protein (.1) Lus10000319 [exp] 108 / 3e-29 AT3G26040 198 / 2e-58 HXXXD-type acyl-transferase family protein (.1) Lus10025867 [exp] 82 / 8e-20 AT3G26040 155 / 2e-43 HXXXD-type acyl-transferase family protein (.1) Lus10002893 [exp] 80 / 1e-18 AT5G47950 195 / 2e-57 HXXXD-type acyl-transferase family protein (.1) Lus10012759 [exp] 76 / 2e-17 AT3G26040 209 / 3e-62 HXXXD-type acyl-transferase family protein (.1) Lus10042994 [exp] 73 / 2e-16 AT3G26040 184 / 3e-53 HXXXD-type acyl-transferase family protein (.1) Lus10016353 [exp] 67 / 5e-14 AT3G26040 201 / 1e-59 HXXXD-type acyl-transferase family protein (.1) Lus10034019 [exp] 65 / 7e-14 AT5G47950 84 / 2e-18 HXXXD-type acyl-transferase family protein (.1) Lus10021392 [exp] 66 / 1e-13 AT3G26040 184 / 6e-53 HXXXD-type acyl-transferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G034300 [exp] 67 / 4e-14 AT3G26040 280 / 1e-89 HXXXD-type acyl-transferase family protein (.1) Potri.008G033500 [exp] 64 / 5e-13 AT3G26040 290 / 3e-93 HXXXD-type acyl-transferase family protein (.1) Potri.011G124268 [exp] 61 / 4e-12 AT3G26040 281 / 2e-90 HXXXD-type acyl-transferase family protein (.1) Potri.011G124500 [exp] 61 / 4e-12 AT3G26040 281 / 2e-90 HXXXD-type acyl-transferase family protein (.1) Potri.008G034200 [exp] 60 / 8e-12 AT3G26040 254 / 9e-80 HXXXD-type acyl-transferase family protein (.1) Potri.011G124184 [exp] 59 / 3e-11 AT3G26040 278 / 5e-89 HXXXD-type acyl-transferase family protein (.1) Potri.011G124300 [exp] 59 / 3e-11 AT3G26040 278 / 5e-89 HXXXD-type acyl-transferase family protein (.1) Potri.011G124156 [exp] 58 / 3e-11 AT3G26040 284 / 2e-91 HXXXD-type acyl-transferase family protein (.1) Potri.011G124128 [exp] 58 / 3e-11 AT3G26040 282 / 1e-90 HXXXD-type acyl-transferase family protein (.1) Potri.008G034100 [exp] 56 / 2e-10 AT3G26040 270 / 4e-86 HXXXD-type acyl-transferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0149 [flax] [poplar] CoA-acyltrans PF02458 [flax] [poplar] Transferase Transferase family
Representative CDS sequence Show only first row Show all	>Lus10004438 pacid=23154253 polypeptide=Lus10004438 locus=Lus10004438.g ID=Lus10004438.BGIv1.0 annot-version=v1.0 ATGGACAAGCTATACTTTCAGGAGAGTGCTGTTATGACTAGGAGATTCGTGTTCAGTAACGGTGCCGTATCAGCGTTGAGGTCGAGGGCAACGAGGAGGA ATGAAATCCGGCCTGGTAGAAATGAAACACTGGCCGCTTTCATTTGGAAAGCAGTGATGAAGGCAGCCGAAACTTGTAAATCACGTAACAATTACCTGGA TTGTTTCAGACAAGCAGTCGATATCAGGTCTAGAATGGGCCGGCGCTTGTCAAGACAGTCCGTTGGGAATCTCGTTGTAGGCCCAATAGCTTCTTGGGAC AGCAAGGATGGTGGATAA
AA sequence Show only first row Show all	>Lus10004438 pacid=23154253 polypeptide=Lus10004438 locus=Lus10004438.g ID=Lus10004438.BGIv1.0 annot-version=v1.0 MDKLYFQESAVMTRRFVFSNGAVSALRSRATRRNEIRPGRNETLAAFIWKAVMKAAETCKSRNNYLDCFRQAVDIRSRMGRRLSRQSVGNLVVGPIASWD SKDGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10004438 [exp]	0	1
AT1G32450		NRT1.5	nitrate transporter 1.5 (.1)		Lus10030286 [exp]	3.0	0.9723
AT1G27220			paired amphipathic helix repea...		Lus10000805 [exp]	4.2	0.9723
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10021338 [exp]	5.2	0.9723
					Lus10033096 [exp]	6.0	0.9723
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10010229 [exp]	6.7	0.9648
AT3G44150			unknown protein		Lus10021005 [exp]	7.3	0.9552
AT1G32910			HXXXD-type acyl-transferase fa...		Lus10006333 [exp]	8.1	0.7465
AT1G31450			Eukaryotic aspartyl protease f...		Lus10002630 [exp]	8.4	0.9538
AT5G63920		TOP3A, AtTOP3al...	topoisomerase 3alpha (.1)		Lus10006779 [exp]	8.5	0.9516
AT4G22410			Ubiquitin C-terminal hydrolase...		Lus10035548 [exp]	9.0	0.9504

Compare expression of checked genes

Lus10004438 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.