Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004442 pacid=23154264 polypeptide=Lus10004442 locus=Lus10004442.g ID=Lus10004442.BGIv1.0 annot-version=v1.0 ATGTCGTCGTCGGATGCATCCGTCGAGTTTTCCAGCGACATGCAAGCTCCGATCTGTAGGGATCTGGTGGAGAGGAAAGGGGACGGTGGCCTCGCTGCCA GAGGACCGCTGATGACAGAACCAGATCGTCGGAAAACGGCCGCTACTTGGTATAATAGAAGGACGCAAATCGCTCGAGAAAGACGGAAAGCAGGAGGATC AGACTCGGGGAGATGA
AA sequence Show only first row Show all	>Lus10004442 pacid=23154264 polypeptide=Lus10004442 locus=Lus10004442.g ID=Lus10004442.BGIv1.0 annot-version=v1.0 MSSSDASVEFSSDMQAPICRDLVERKGDGGLAARGPLMTEPDRRKTAATWYNRRTQIARERRKAGGSDSGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10004442 [exp]	0	1
AT2G42140			VQ motif-containing protein (....		Lus10004172 [exp]	2.4	0.9237
AT3G47570			Leucine-rich repeat protein ki...		Lus10037310 [exp]	3.2	0.9316
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10032219 [exp]	5.3	0.9314
AT1G52820			2-oxoglutarate (2OG) and Fe(II...		Lus10041280 [exp]	6.9	0.9040
AT5G38200			Class I glutamine amidotransfe...		Lus10039726 [exp]	8.8	0.8943
AT4G17905		ATL4H	RING/U-box superfamily protein...		Lus10027736 [exp]	13.0	0.9109
AT5G57190		PSD2	phosphatidylserine decarboxyla...		Lus10035633 [exp]	15.3	0.9242
AT5G15920		EMB2782, SMC5	EMBRYO DEFECTIVE 2782, structu...		Lus10005338 [exp]	16.0	0.9254
AT2G37050			Leucine-rich repeat protein ki...		Lus10019237 [exp]	24.2	0.9271
AT2G21610		PE11, ATPE11	A. THALIANA PECTINESTERASE 11,...		Lus10000045 [exp]	25.5	0.8904

Compare expression of checked genes

Lus10004442 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.