Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023405 [exp] 47 / 7e-09 ND / Lus10024981 [exp] 42 / 1e-06 ND / Lus10021245 [exp] 39 / 4e-05 AT5G22000 336 / 2e-113 RING-H2 group F2A (.1.2.3) Lus10017783 [exp] 38 / 0.0001 ND / Lus10039552 [exp] 37 / 0.0002 ND 60 / 9e-10 Lus10017916 [exp] 35 / 0.0004 ND / Lus10034855 [exp] 35 / 0.0005 ND / Lus10009245 [exp] 35 / 0.0005 ND 35 / 0.004 Lus10003597 [exp] 35 / 0.0008 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004450 pacid=23146099 polypeptide=Lus10004450 locus=Lus10004450.g ID=Lus10004450.BGIv1.0 annot-version=v1.0 ATGGAATATGTGTACGAAGAACCTTCTCAATGCGTCAACACTGATCTCATCAAGGGACAAATACTTTGGAGCGACCACAACCGACACATAACATGGGACA TGTACAACAATGAGGCCAGATCGGGTAGTCATGTAGCTTGGGATGGGGCAGCAGGTCCCACACTGGGAGACTGGTGA
AA sequence Show only first row Show all	>Lus10004450 pacid=23146099 polypeptide=Lus10004450 locus=Lus10004450.g ID=Lus10004450.BGIv1.0 annot-version=v1.0 MEYVYEEPSQCVNTDLIKGQILWSDHNRHITWDMYNNEARSGSHVAWDGAAGPTLGDW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10004450 [exp]	0	1
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10025409 [exp]	2.8	0.9161
AT5G05970		NEDD1	NEURAL PRECURSOR CELL EXPRESSE...		Lus10040260 [exp]	6.0	0.8945
AT4G08180		ORP1C	OSBP(oxysterol binding protein...		Lus10035967 [exp]	9.3	0.8550
AT5G67265			unknown protein		Lus10042633 [exp]	13.2	0.8734
AT1G67910			unknown protein		Lus10023632 [exp]	16.4	0.9114
					Lus10018670 [exp]	19.0	0.8820
AT2G45510		CYP704A2	"cytochrome P450, family 704, ...		Lus10038896 [exp]	21.1	0.9108
AT5G05960			Bifunctional inhibitor/lipid-t...		Lus10004677 [exp]	21.8	0.8965
AT3G27890		NQR	NADPH:quinone oxidoreductase (...		Lus10026172 [exp]	23.5	0.8777
					Lus10013906 [exp]	29.2	0.8273

Compare expression of checked genes

Lus10004450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.