Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G027500 [exp] 74 / 1e-18 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004492 pacid=23169695 polypeptide=Lus10004492 locus=Lus10004492.g ID=Lus10004492.BGIv1.0 annot-version=v1.0 ATGACTTTCTTTGCAGCGACTGGCCTCCTTGCCCTTTGCAGCTTCAGTAAAGACGTATATCTCAGAAGTTGCGGGCGTTCAACTACTCCATTAGGACATT TAAGTGACCTTTTTCCTTGTTGTATGAATGTAGGTTCTAGTAGTCACAAAAGAATAACTGGTTTCTGGGTTGGACCAGATATTGACGATGGTTGGGGATT GGTCGAAGCTTCTGTCAATCAAGTTACTTCACTCTAG
AA sequence Show only first row Show all	>Lus10004492 pacid=23169695 polypeptide=Lus10004492 locus=Lus10004492.g ID=Lus10004492.BGIv1.0 annot-version=v1.0 MTFFAATGLLALCSFSKDVYLRSCGRSTTPLGHLSDLFPCCMNVGSSSHKRITGFWVGPDIDDGWGLVEASVNQVTSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10004492 [exp]	0	1
AT5G07940			unknown protein		Lus10034693 [exp]	5.5	0.7722
AT1G12700		RPF1	RNA processing factor 1, ATP b...		Lus10020134 [exp]	16.8	0.7653
AT5G55470		ATNHX3	Na+/H+ \(sodium hydrogen\) exc...		Lus10014891 [exp]	25.2	0.7436
AT5G05970		NEDD1	NEURAL PRECURSOR CELL EXPRESSE...		Lus10004693 [exp]	31.7	0.7226
AT1G62680			Pentatricopeptide repeat (PPR)...		Lus10025942 [exp]	55.0	0.7301
AT1G62930		RPF3	RNA processing factor 3, Tetra...		Lus10003429 [exp]	66.1	0.6875
AT1G12700		RPF1	RNA processing factor 1, ATP b...		Lus10003427 [exp]	71.2	0.7178
AT5G63810		BGAL10	beta-galactosidase 10 (.1)		Lus10025110 [exp]	83.3	0.6792
					Lus10042563 [exp]	85.0	0.7098
AT2G43980		ATITPK4	"inositol 1,3,4-trisphosphate ...		Lus10006145 [exp]	95.2	0.7023

Compare expression of checked genes

Lus10004492 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.