Lus10004507 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017778 125 / 8e-35 AT5G08020 75 / 3e-14 ARABIDOPSIS THALIANA RPA70-KDA SUBUNIT B, RPA70-kDa subunit B (.1)
Lus10018804 65 / 6e-13 AT1G75050 171 / 4e-71 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10015932 64 / 2e-12 AT2G05642 52 / 3e-07 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10012660 48 / 5e-07 ND 169 / 1e-48
Lus10004773 0 / 1 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10004507 pacid=23182195 polypeptide=Lus10004507 locus=Lus10004507.g ID=Lus10004507.BGIv1.0 annot-version=v1.0
ATGACGATCAACACAATCAATGAGCTCAACACTAGGCCAGAGATGTGGATCTCACAAGTAAGGGTCAGTCGAAGTTGGGTGGCAACAAATCCCAAAAATG
TTATCCTTCACAGAGATCTCACTCTCATGGATGAAAAGGGAGATGATATATGGGCTAAAGTGCCGCTACACCTCATGCCGAACTTTGAACACCTCTTACA
GGAGCAAAAGGTGTACACTATTCGGGACTTCAGAGTGAAGCACACCCCAAAAGAATACAAACCCATTGAATTCTCAGCTACAACCATTGTGGAGGAAGTA
GAAGACATGACCACCATTCCAAAACACAAATTCACATTCATCAAGGAAACTGAGATCGCAAGCAAGCTAGGAGACATAATGCTACTACACGGTAACAACG
TTTCACTCATATAG
AA sequence
>Lus10004507 pacid=23182195 polypeptide=Lus10004507 locus=Lus10004507.g ID=Lus10004507.BGIv1.0 annot-version=v1.0
MTINTINELNTRPEMWISQVRVSRSWVATNPKNVILHRDLTLMDEKGDDIWAKVPLHLMPNFEHLLQEQKVYTIRDFRVKHTPKEYKPIEFSATTIVEEV
EDMTTIPKHKFTFIKETEIASKLGDIMLLHGNNVSLI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10004507 0 1
Lus10005514 5.1 0.8818
AT4G26270 PFK3 phosphofructokinase 3 (.1) Lus10035001 5.4 0.7497
AT1G30190 unknown protein Lus10038508 5.8 0.7145
Lus10000529 7.2 0.8818
AT2G04865 Aminotransferase-like, plant m... Lus10014633 8.8 0.8818
AT5G27260 unknown protein Lus10007175 10.2 0.8818
AT1G23980 RING/U-box superfamily protein... Lus10022223 11.1 0.6809
AT3G05140 RBK2 ROP binding protein kinases 2 ... Lus10018959 11.2 0.6394
Lus10008001 11.4 0.8818
AT3G13790 ATCWINV1, ATBFR... ARABIDOPSIS THALIANA CELL WALL... Lus10037633 12.5 0.8818

Lus10004507 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.