Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01830 257 / 2e-78 ABCB5, PGP5 ATP-binding cassette B5, P-glycoprotein 5 (.1) AT1G02520 246 / 1e-74 MDR8, ABCB11, PGP11 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) AT4G01820 243 / 7e-74 ABCB3, MDR3, PGP3 ATP-binding cassette B3, P-glycoprotein 3 (.1) AT1G02530 243 / 2e-73 ABCB12, PGP12 ATP-binding cassette B12, P-glycoprotein 12 (.1) AT2G47000 240 / 2e-72 PGP4 ,MDR4, ABCB4, ATPGP4 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) AT5G46540 238 / 1e-71 ABCB7, PGP7 ATP-binding cassette B7, P-glycoprotein 7 (.1) AT3G62150 231 / 2e-69 ABCB21, PGP21 ATP-binding cassette B21, P-glycoprotein 21 (.1) AT4G18050 218 / 5e-65 ABCB9, PGP9 ATP-binding cassette B9, P-glycoprotein 9 (.1) AT3G28860 175 / 9e-50 ABCB19, ATMDR11, ATMDR1, PGP19, MDR11, MDR1, ATPGP19, ATABCB19 P-GLYCOPROTEIN 19, MULTIDRUG RESISTANCE PROTEIN 11, Arabidopsis thaliana ATP-binding cassette B19, ATP-binding cassette B19, ATP binding cassette subfamily B19 (.1) AT4G25960 164 / 4e-46 ABCB2, PGP2 ATP-binding cassette B2, P-glycoprotein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010074 [exp] 362 / 7e-116 AT1G02520 1591 / 0.0 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) Lus10010067 [exp] 265 / 2e-81 AT1G02520 1748 / 0.0 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) Lus10009989 [exp] 261 / 5e-80 AT2G47000 1754 / 0.0 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) Lus10038050 [exp] 258 / 6e-79 AT2G47000 1697 / 0.0 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) Lus10038049 [exp] 255 / 6e-78 AT3G62150 1891 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Lus10009988 [exp] 254 / 1e-77 AT3G62150 1896 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Lus10004520 [exp] 250 / 1e-77 AT2G47000 1145 / 0.0 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) Lus10010068 [exp] 252 / 9e-77 AT3G62150 1820 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Lus10004583 [exp] 200 / 2e-58 AT4G18050 1660 / 0.0 ATP-binding cassette B9, P-glycoprotein 9 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G187500 [exp] 278 / 6e-86 AT3G62150 1860 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.014G113000 [exp] 271 / 2e-83 AT3G62150 1767 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.002G187400 [exp] 261 / 6e-80 AT3G62150 1702 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.014G113500 [exp] 259 / 3e-79 AT3G62150 1879 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.014G113200 [exp] 258 / 7e-79 AT3G62150 1871 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.001G354900 [exp] 257 / 1e-78 AT4G18050 1723 / 0.0 ATP-binding cassette B9, P-glycoprotein 9 (.1) Potri.010G003000 [exp] 254 / 1e-77 AT2G47000 1585 / 0.0 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) Potri.014G113100 [exp] 254 / 2e-77 AT1G02520 1773 / 0.0 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) Potri.017G081100 [exp] 170 / 3e-48 AT3G28860 2107 / 0.0 P-GLYCOPROTEIN 19, MULTIDRUG RESISTANCE PROTEIN 11, Arabidopsis thaliana ATP-binding cassette B19, ATP-binding cassette B19, ATP binding cassette subfamily B19 (.1) Potri.003G094400 [exp] 165 / 2e-46 AT4G25960 2000 / 0.0 ATP-binding cassette B2, P-glycoprotein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0241 [flax] [poplar] ABC_membrane PF00664 [flax] [poplar] ABC_membrane ABC transporter transmembrane region
Representative CDS sequence Show only first row Show all	>Lus10004529 pacid=23182176 polypeptide=Lus10004529 locus=Lus10004529.g ID=Lus10004529.BGIv1.0 annot-version=v1.0 ATGGGTGAAAAGGTGGGAAAATTTCTACAATTGGGAGCAACATTTGTTGGAAGTTTGGTTGTAGCATTTATAAGAGGGTGGAGGCTTGCCTTGGTAATAA TGTATGTTATTCCATTCATGGTGCTTGCCGGCGGCATAATGGCTAAGGTGGCATCATTTACTGGGGAGAAACGAGCCACAACTGCTTACAATAAGTTTCT TGATAAAACATACAAATCAAGCGTGAGACAAAGTATAGCTGCAGGGTTAGGGATGACCATGGTGATGATGGTTATATTCCCTAGTTATGCCTTTGGCTGT TTGGTATGGTGGGAAATTGATTTTGAACAAGGATTATTCTGGTGGTCAAGTTCTCAACGTTCTCCTGGCCCTTTTGACTGTTCCATGTCACAAGGACAAA CAGCTTCCTACATCAGTGCATTTGCAACAGGCAAATCTGCAGCTTACGAGATGTTTGAAACTATCAACCGGCGCCCCGAGATTGACACTTACGATTCTAG TGGAAGAGTACTAGAAGATATTCGAGGGGATATCGAGATGAGGGAATTGTATTTCAGTTATCCAGATAGACCAGAAGAACAAATTTTAAGTGGGTTTTCT CTGGTCATCCCCAGTGGAACAAGAGCAGCACTGGTGGGGCACAGTGGGAGTGGGAAATCTACTGTGATCAGTTTGATTGAGAGGTTCTATGATCCTCAGT CTGGAGAGGTTCTCATTGATGGGATCAACCTCAAAGACTGTTGA
AA sequence Show only first row Show all	>Lus10004529 pacid=23182176 polypeptide=Lus10004529 locus=Lus10004529.g ID=Lus10004529.BGIv1.0 annot-version=v1.0 MGEKVGKFLQLGATFVGSLVVAFIRGWRLALVIMYVIPFMVLAGGIMAKVASFTGEKRATTAYNKFLDKTYKSSVRQSIAAGLGMTMVMMVIFPSYAFGC LVWWEIDFEQGLFWWSSSQRSPGPFDCSMSQGQTASYISAFATGKSAAYEMFETINRRPEIDTYDSSGRVLEDIRGDIEMRELYFSYPDRPEEQILSGFS LVIPSGTRAALVGHSGSGKSTVISLIERFYDPQSGEVLIDGINLKDC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G01830		ABCB5, PGP5	ATP-binding cassette B5, P-gly...		Lus10004529 [exp]	0	1
					Lus10011061 [exp]	1.0	1.0000
					Lus10009800 [exp]	1.4	1.0000
AT3G25050		XTH3	xyloglucan endotransglucosylas...		Lus10011845 [exp]	2.2	1.0000
					Lus10011848 [exp]	2.4	1.0000
AT3G07740		HXA2, HXA02, HA...	homolog of yeast ADA2 2A (.1.2...		Lus10012337 [exp]	2.6	1.0000
AT4G10020		ATHSD5	hydroxysteroid dehydrogenase 5...		Lus10001280 [exp]	2.8	1.0000
AT1G12570			Glucose-methanol-choline (GMC)...		Lus10002957 [exp]	3.0	1.0000
					Lus10011496 [exp]	3.0	1.0000
AT3G20760			Nse4, component of Smc5/6 DNA ...		Lus10004185 [exp]	3.2	1.0000
AT5G46795		MSP2	microspore-specific promoter ...		Lus10004566 [exp]	3.3	1.0000

Compare expression of checked genes

Lus10004529 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.