Lus10004534 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44020 469 / 6e-165 Mitochondrial transcription termination factor family protein (.1)
AT4G02990 280 / 2e-90 RUG2, BSM RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
AT2G21710 130 / 2e-33 EMB2219 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
AT4G38160 112 / 2e-28 PDE191 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
AT1G78930 107 / 9e-26 Mitochondrial transcription termination factor family protein (.1)
AT4G14605 107 / 1e-25 Mitochondrial transcription termination factor family protein (.1)
AT5G55580 95 / 2e-21 Mitochondrial transcription termination factor family protein (.1)
AT5G54180 75 / 1e-14 PTAC15 plastid transcriptionally active 15 (.1)
AT2G03050 69 / 3e-13 SOLDAT10, EMB93 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1)
AT2G34620 69 / 4e-13 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004614 612 / 0 AT2G44020 707 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10014877 306 / 1e-100 AT4G02990 665 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Lus10022321 222 / 1e-68 AT4G02990 540 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Lus10042322 129 / 6e-33 AT2G21710 720 / 0.0 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
Lus10013854 102 / 2e-24 AT4G38160 446 / 2e-158 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
Lus10032061 102 / 1e-23 AT4G14605 521 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10035227 101 / 1e-23 AT4G14605 518 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10035714 99 / 8e-23 AT1G78930 582 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10003775 95 / 2e-21 AT5G55580 546 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G116700 478 / 3e-168 AT2G44020 764 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.014G137400 310 / 3e-102 AT4G02990 669 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Potri.009G116200 127 / 2e-32 AT2G21710 748 / 0.0 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
Potri.017G067600 114 / 4e-28 AT4G14605 571 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.004G209400 103 / 3e-25 AT4G38160 481 / 3e-172 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
Potri.007G001800 102 / 5e-24 AT1G78930 633 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.009G170300 100 / 2e-23 AT4G38160 479 / 8e-170 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
Potri.001G361800 92 / 2e-20 AT5G55580 584 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034600 77 / 2e-15 AT5G07900 197 / 4e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.015G005200 76 / 6e-15 AT5G54180 493 / 3e-171 plastid transcriptionally active 15 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10004534 pacid=23159371 polypeptide=Lus10004534 locus=Lus10004534.g ID=Lus10004534.BGIv1.0 annot-version=v1.0
ATGCCTGTTGTCAAGTTCCTTCGCGGACTTGATGTCGAGAAGCAAGATATCGGATATGTACTCCTAAAGTATCGTGAGCTTCTTGGCTTTAAACTCGAAG
GAACGATGAGTACCTCTGTCGCTTATCTTGTTAGTATTGGTGTTAGTCCGAGAGATATTGGACCGATGGTGACTCAGTATCCGTTCCTTTTGGGGATGCG
AGTAGGGACTGTGATCAAGCCGTTTGTTGATTACATGGTCTCTTTAGGCTTGCCAAAAAAGATCATAGCTAGGATGCTGGAGAAGCGGCCGTACATCCTT
GGATACAATCTTGAAGAAACTTTGAAGCCGAATATAGAGTGTTTGGTCAGTTTCGGTGTTAGGAAAGAATCGCTAGGTTTTGCTACAGCGCAATACCCGC
AGATTCTCAGGTTGCCTTTGAAAGCGAAGCTTTCTTCTCAACAATACTTCTTCGGTTTGAAGCTCAAGATAGACCCGGACGGTTTTGCACAGGTGATAAA
GAAGATGCCTCAGATTGTAAGCCTTAGTCAACAAGTGATAGTGAAACCTTTTCAGTTCCTTCTCGAGAGGGGTATCCCGGCTCACGACGTAGCAAAGATG
GTCGTCAAGTGTCCTCAGTTGCTTGCGTCGAGAGTCACACTGATGAAGAATAGCTTCTATTTTTTCAAGAGCGAAATGGGAAGGCCGGTGAAAGTGCTTG
TTGATTTCCCAGAGTTTTTCACTTACAGCTTGGAGTCGAGAATCAAACCCAGATATCAAGTGATGAAAAGCAAAGGTGTAAGGTGTTCACTTGATTCCCT
CCTGAACTGTAGTGACCAGAGATTTGAGGAAATGCTGCAAATCGGTGGTAGTCTTGAATCTGAGATGATGGCTGGTCCTTGTTTCAGTATGGGAGGGAAG
TTGCAGTTACCGAGGGACGAGATTGTTTCGGAATCGGACGAGGAAGATGATGATGAGAGTGATCACGAGATACTCTATAGGCGCACTGTATCTATCTGA
AA sequence
>Lus10004534 pacid=23159371 polypeptide=Lus10004534 locus=Lus10004534.g ID=Lus10004534.BGIv1.0 annot-version=v1.0
MPVVKFLRGLDVEKQDIGYVLLKYRELLGFKLEGTMSTSVAYLVSIGVSPRDIGPMVTQYPFLLGMRVGTVIKPFVDYMVSLGLPKKIIARMLEKRPYIL
GYNLEETLKPNIECLVSFGVRKESLGFATAQYPQILRLPLKAKLSSQQYFFGLKLKIDPDGFAQVIKKMPQIVSLSQQVIVKPFQFLLERGIPAHDVAKM
VVKCPQLLASRVTLMKNSFYFFKSEMGRPVKVLVDFPEFFTYSLESRIKPRYQVMKSKGVRCSLDSLLNCSDQRFEEMLQIGGSLESEMMAGPCFSMGGK
LQLPRDEIVSESDEEDDDESDHEILYRRTVSI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44020 Mitochondrial transcription te... Lus10004534 0 1
AT1G29850 double-stranded DNA-binding fa... Lus10004540 5.5 0.8219
AT1G02290 unknown protein Lus10018907 6.9 0.7944
AT5G49060 Heat shock protein DnaJ, N-ter... Lus10006515 7.2 0.7964
AT3G18165 MOS4 modifier of snc1,4 (.1) Lus10018001 11.2 0.7917
AT3G18165 MOS4 modifier of snc1,4 (.1) Lus10041997 12.0 0.7925
AT2G45520 unknown protein Lus10009304 12.6 0.7864
AT5G40660 ATP12 protein-related (.1) Lus10000142 13.4 0.7932
AT5G06240 EMB2735 embryo defective 2735 (.1) Lus10021327 14.7 0.7797
AT4G09550 ATGIP1 ARABIDOPSIS ATGCP3 INTERACTING... Lus10040621 15.9 0.7586
AT1G10150 ATPP2-A10 Carbohydrate-binding protein (... Lus10012487 18.0 0.7699

Lus10004534 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.